SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G18900.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G18900.1
Domain Number 1 Region: 205-477
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.79e-31
Family Pseudouridine synthase RsuA/RluD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G18900.1   Gene: BRADI1G18900   Transcript: BRADI1G18900.1
Sequence length 482
Comment pep:novel chromosome:Brachy1.0:1:15126230:15129715:1 gene:BRADI1G18900 transcript:BRADI1G18900.1
Sequence
MPKPAATLASLLLPQLRHRPFPPPPPLLPRALSFSSTSSPLVAARRRFRFSPTTHLAVTA
AAVSNVAVEAPAPTAYPAYDRILPCPAQDDPPRIEHLVAREDEAAGDFISRSLGLPPLYV
ADLIKFGAVYYALVAPQPPPYAAPEHVRIFREVTEPSVLRRRASIKGKTVREAQKTFRVT
DPGQHLEAGTYLRVHVHPKRFPRCYQIDWKSRVIAVTDNYVVLNKPAATSVGGATDNIEE
SCVVFTSRALGVDSPLMTTHQIDNCSEGCVVLSKTKEFCSVFHGLIREKQVKKLYLALTT
KPVSPGIITHYMRPLNRAPRLVSEDHIGGWHLCQMEILDCTKVPWPKPLITKVHNVDNCG
WPRQEAAYECKINLMTGKTHQIRAQLAAIGAPIIGDSAYMTGAIAAMANPSINPYGRESL
NYNSEEEKAAAVEAWVACHGKEPKSVIGLQASEISWDHEGEHHYYKAGVPWWRQDSVESD
LV
Download sequence
Identical sequences I1GRI9
XP_010229578.1.954 EG:BRADI1G18900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]