SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G19100.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G19100.1
Domain Number 1 Region: 190-383
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00072
Further Details:      
 
Domain Number 2 Region: 24-140
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-17
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G19100.1   Gene: BRADI1G19100   Transcript: BRADI1G19100.1
Sequence length 862
Comment pep:novel chromosome:Brachy1.0:1:15307242:15317349:-1 gene:BRADI1G19100 transcript:BRADI1G19100.1
Sequence
MAAAAVAERQQQQRGGAAAAAAASGGAVFKSGPLFISSKGIGWKSWKKRWFILTRTSLVF
FKSDPNTLPQRGGEVNLTLGGIDLNSSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETSE
DLFEWKIALEEALALAPNAALVMGHNGIFRNDTTDAYEGAAPNLREKRPTKSLVVGRPIL
LALEDIDGSPSFLEKALCFLEKHGIKVEGILRQAADVEEVDRRMNEYEQGRTEFAPDEDA
HVVGDCVKHVLRELPSSPVPASCCTALLEAFRLESKESRINSMRAAISETFPEPNRRLLQ
RILRMMHTVASHTTNNRMTPSAVAACMAPLLLRPLLAGECEMEDDIDMNGDNSAQLIAAA
IAANSAQGIVTTLLEDYEGIFDDEHPRCSLSPDSRIQDSGSEESTDDETVDAKENGFHDA
ENDVDQELDERILSGKLSESSACIGGDLYDYQVDHGDSDTEPYVEDKEANLDLKDAPNSH
LAQNGKINVQRPLNEKDPTNLVSSHESPLSVGEILSSLDAGVRLPGPGAEYSVDSHSIKS
NETQLHVKRSNIWGRNNARKSQQTEFVDSSGEEELAIQRLEIAKNDLQIRIAKETRGNAI
LQASLERRKQALHERRLVLEQDVSRLQEQLQAERDLRAALEVGLSMSSAQFSSSRAMDSK
TKAELEEIALAEADVARLKQKVAELHVQLSQQRQHQYGSSGDENDRYQHRPSHLPQNFVQ
PGFDMKLASCNQEKKQRHEESLSGASHWRSIKQHVLTHGSSKPFSRKHSLDASSSDSREA
STSMAAESGLMSSNIPRATEAVEYGRQLPVPSSTLVELTTRLDFFKERRSQLMEQLHSLD
LGHGSAPHGFPYKPSPPWNSQR
Download sequence
Identical sequences I1GRL1
EG:BRADI1G19100.1 15368.BRADI1G19100.1 XP_010234543.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]