SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G19290.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G19290.1
Domain Number 1 Region: 405-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-64
Family Protein kinases, catalytic subunit 0.00044
Further Details:      
 
Domain Number 2 Region: 270-363
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000143
Family Growth factor receptor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G19290.1   Gene: BRADI1G19290   Transcript: BRADI1G19290.1
Sequence length 730
Comment pep:novel chromosome:Brachy1.0:1:15436760:15440710:1 gene:BRADI1G19290 transcript:BRADI1G19290.1
Sequence
MGAATILVLLATTHAILAAQQRPITLAGCPDKCGDISIPFPFGMKPGCFLEGFEVTCNHS
FNPPRAFLSQDSIYQRVGYANYTTRNYSDLGTLNPVDVLNVSNVPAELIDISVPGVSSGH
TAWFGGRRPFLLSPLRNVVIGVGWDVQPEMAFGRSIDNETRYMIGCLSYIKHSFLTNGSC
SGRGCCEASIPSEKDVDFSIRAFTVVFEPQKERDMPGDDMSTNSPCSYAMMVERSWYNFS
SEDMFGRMVLPNKYPRGVPFVLDFAIRNRSCTAQGQQPPQDYACISGNSYCAKAPSGNGY
VCRCQDNYDGNPYITNGCQDINECDLHPKNNCSAGSFCKNTPGGYECPCKVGMKGNGKKG
PCTENFPMPAKVIVGVSSSIVVVVLMLMVNQFLKLKKFYEQNGGPILKGVKNIRIYTRKQ
LKQITGNYKHPIGEGAFGKVYLGTLEDKQQVAIKRSIKVEKERTKEFTDEVIIQSEMRHK
NIVRLLSCCLEVDVPILVYEFVPRGSLYEVLFRGGDSIPVNTRLRIAVGTAEGLAYMHSA
GQSTIRHGDVKSANILLDEIFIPKVSDFGTSSLLARGTDEMTENVIGDKSYIDPIYMQEG
IVTQKSDVYSFGVVLIELVTRRAAKYDKERSYIKNFVQACLGKRAREFFDNDITSDEDIK
ILEMVSEVAVECLKTNPEERLHMRQVESRLFYISAQSVHYGQETNDLRNLSPSPEDIALP
TSGENEASTD
Download sequence
Identical sequences I1GRN2
EG:BRADI1G19290.1 15368.BRADI1G19290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]