SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G20510.3 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G20510.3
Domain Number 1 Region: 496-564
Classification Level Classification E-value
Superfamily LCCL domain 0.000011
Family LCCL domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G20510.3   Gene: BRADI1G20510   Transcript: BRADI1G20510.3
Sequence length 789
Comment pep:novel chromosome:Brachy1.0:1:16399024:16403619:-1 gene:BRADI1G20510 transcript:BRADI1G20510.3
Sequence
MSGAPKRLPEEGSHSTPAKRPLDESSLYSSPSGKLIQPGSTDFHGSIEHDGRSAKIQRVE
RSLPHRIHVSSSNFVDHPTSSDSRLEAKQNKDGRETKVEDREAKADARDVHSDTRIEFQG
NKVETDVKTDSRADDNEIRADRRVHTEYKGDAKLDKDGHPAGTSHLAWKDNKDHRGKRYA
EQPDDNAGWRFLRPALQGTDETPKVPTPVEEWNSKDAHESTGESKIEPRSEDKFRDKDRR
KKDEKHRDFGARDGDRNDRRIGIQLAGSSVERREIQRDDRDAEKWDRERKDSQKDKEGND
REKDSAKKDSFLAVDKENAILEKAASDGAVKTAEHENTATELKTLKDDKSHDRDPKDKKR
EKDVDTGDRNDQRSKYNDKESDDTGPEGDTDKDKDTFGSIQRRRMARPRGGGGQASQREP
RFRSKMRDGEGSQGKSEVSAIVYKAGECMQELLKSWKEFEATPDAKNAENQQDGPTLEIR
IPAEFVTSTNRQVKGAQLWGTDVYTNDSDLVAVLMHTGYCSPTSSPPPSAIQELRATVRV
LPPQDSYTSTLRNNVRSRAWGAGIGCSFRIERCCIVKKGGGTIDLEPRLSHTSAVEPTLA
PVAVERTMTTRAAASNALRQQRFVREVTIQYNLCNEPWLKYSISIVADKGLKKSLYTSAR
LKKGEVIYLETHFNRYELCFSGEKPRSVGSNSSASDLEPEKHHNSSHHHSQNGDRGTAEH
ELRDMFRWSRCKKAMPETAMRSIGIPLPAEQLEVLQDNLEWEDVQWSQTGVWVSGKEYPL
ARVHFLSSN
Download sequence
Identical sequences I1GS22
XP_003562631.1.954 EG:BRADI1G20510.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]