SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G21110.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G21110.1
Domain Number 1 Region: 145-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-82
Family Protein kinases, catalytic subunit 0.00000252
Further Details:      
 
Domain Number 2 Region: 440-590
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000579
Family Calmodulin-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G21110.1   Gene: BRADI1G21110   Transcript: BRADI1G21110.1
Sequence length 601
Comment pep:novel chromosome:Brachy1.0:1:16995159:16999929:-1 gene:BRADI1G21110 transcript:BRADI1G21110.1
Sequence
MGGCHAKPLTHDANDGSPPRAAPATPPPQASAPATPATKKHWTSSPFFPFSTPSPSPAHH
LFSSSSAASPRTTKQSPAGSTTPNTPARRLLRLPFPPPSPAKHIRQALARRHGPTRPAIP
EEGGDGDGGGRGLDKGFGFNKAFAAKYEMGDEVGRGHFGYTCAARIKKGARKGEAVAVKV
IPKAKMTTSIAIEDVRREVKILKALAGHKNLVQFYDAYEDNENVYIVMELCEGGELLDRI
LSRGGKYSEDDAKAVLVQILNVVAFCHIQGVVHRDLKPENFLFSSKDENSQLKTIDFGLS
DFVKPDERLNDIVGSAYYVAPEVLHRCYSTEADVWSIGVIAYILLCGSRPFWARTESGIF
RSVLKADPSYNEAPWPSLTPEAMDFVKRLLCKDPRRRMTAAQALGHPWIRNYNDIKMPLD
ILIFRLIKAYIRSSSLRKAALRALSKTLTVDELFYMKGQFSLLEPDRNGCITLDNIRMAL
TREATDAMKETRVQEILVSLSALQYRRMDFHEFCAAAVSVHQLEALDRWEQHARSAYELF
ERDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKI
R
Download sequence
Identical sequences I1GS85
EG:BRADI1G21110.1 XP_003562669.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]