SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G22540.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G22540.1
Domain Number 1 Region: 565-864
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-75
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 470-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000319
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G22540.1   Gene: BRADI1G22540   Transcript: BRADI1G22540.1
Sequence length 903
Comment pep:novel chromosome:Brachy1.0:1:18056829:18060359:1 gene:BRADI1G22540 transcript:BRADI1G22540.1
Sequence
MGLSHFGVAVSLLVLAVAGFGVAKEGKGDLTLPSKASLAGCRKRCGNLTFDYPFGVGPGC
SRGGDFELICHESAEEHKLFLHDGITRVSYNVEMARQSLWSTTYIDSDNKETTDMRGNFM
LINFNRVIPMEPGVSNYSMNWTVPGKSFYFEDVDLTIFGCDFTAHLVDKSGKLLHKCESS
CPGGRTPTESEAATSCNDEVGVGCCKLSNSMYNNTGTFHLRIIRQGDGGDPGQGEGASPL
QDTITVVGDRFPLSWKIMDTSGCNRSSPSYACVDINSKCRSHNDLYGGYTCTCRDEYVGD
PYILDGCTTDQDYHPTPIRPNCPPIPKCGDIEVPFPFGLEEGCSARKIFQLNCTYASSSS
KLLLNKYLQVTKIEVNQGLIQCNDTNNTEQYYTTFNGDLYGSLPFLPSKGSIPLRWVAAN
LTCEAARKNSSSYACRNDKSMCKEEEIEGSFYGYRCQCSAGFGGNPYIEHGCEDINECLE
GTDKCKGLCRNTVGSYNCISYLLLAAIVGLTGTVGILLLLFATILVIRRQKSYIRQKQQR
KYFQKNHGLLLQQLISSDENARHNTKIFSQQELEKATNNFDPAFILGRGGHGMVYKGILS
DQHVVAIKKSNVIKDGEINQFINEVAILSQINHRNIVKLFGCCLETEVPLLVYDFVPNGS
LYEVLHEDTSSGFSLSWYDCLRIAAEAAGALSYLHSAASISIFHRDVKSSNILLGNNYTA
KVSDFGASRSVPANQTHVVTNIQGTFGYLDPEYYRSGQLNQKSDVYSFGVVLVELLLRKK
PIFIDESGLHQNLAYYFLEQFKGRQIREIISPQVLEETTEEEIDDVCSLVEACLRLRGDE
RPTMREVEATLQLLRAKRLTDAAKGPCQPPSVDFGARANLASEDGYSYRSLEQECLSSID
LPR
Download sequence
Identical sequences I1GSQ1
XP_014751156.1.954 15368.BRADI1G22540.1 EG:BRADI1G22540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]