SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G22566.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G22566.1
Domain Number - Region: 110-204
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0175
Family Myosin rod fragments 0.0049
Further Details:      
 
Domain Number - Region: 20-68
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0619
Family Leucine zipper domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G22566.1   Gene: BRADI1G22566   Transcript: BRADI1G22566.1
Sequence length 434
Comment pep:novel chromosome:Brachy1.0:1:18087670:18092070:1 gene:BRADI1G22566 transcript:BRADI1G22566.1
Sequence
MSSSSNGAKVLPKREKNNQEKLQLDKNAASRACAKDRQYIEKLETELRNCYQEIDYLQDQ
LNIRNIEANIMGEHIHGLELKLTELEKFPERVRVMDNDLMRSDSQCWLLMEEVQCKEEEL
QKAALQIEKLESATLDSQCEIESLKLDLTTLEQKLFDAESFGQHTVEFKARMEKQLWDYE
LQLQAAQNTIDNLELEKKQLTEELLSRRALKLSSSTAEEQLYKTSGHDGNANCEEDHEIL
EKMAKQNEEPELLIEQLKVELREQKLKAKEDAEDLTQEMAELRYQITGMLEEEYKRRSCI
EQAAIQQIQQLEAQISGEQRKLSGALRRLQESHELAKTQDMEIKKLKDALGRLNSMAKFG
RVCKSCSCGFCPMLPELSNCSIEGSVDVGSSNANNIDEKSENQALLEWRHIDEKSENQAL
LEWRPDEASEGDAG
Download sequence
Identical sequences I1GSQ4
EG:BRADI1G22566.1 XP_003562757.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]