SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G23710.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G23710.1
Domain Number 1 Region: 338-648
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-78
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 27-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.79e-67
Family Legume lectins 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G23710.1   Gene: BRADI1G23710   Transcript: BRADI1G23710.1
Sequence length 683
Comment pep:novel chromosome:Brachy1.0:1:19091278:19093529:1 gene:BRADI1G23710 transcript:BRADI1G23710.1
Sequence
MMSMLALVLVLLLSLGGEVAWAQEDGQFSYQGFSRANVTLEDSATVMPNGLLSLTNSTYQ
TESKGYVFHHTPISFLTRPTATTTNTTAVARSFSTSFVFAIDAGFGGLSSYGLAFVVSST
TDFSTASSGKYMGLLNATNSTGSDRILAIELDTVMNPEFGDINSNHVGIDVNSLISLQAK
PAGYYSDNDGAFRNLSLSSRTPMLAWVDYDGQAKQLNVTLAPMQVTKPKTPLLSEAIDLS
NVMADTMYVGFASSAGIILTTRHYVLGWSFSLDGPAPPLDFSKLPTLPRVGPKPRSKVFD
VVLPLATALLVAAVLAAIFFFLWRQHRFAEVQEDWEDEFGPHRFTYKDLFLATNGFKEKN
LLGIGGFGRVYKGVLPATNLEIAVKRVSHDSKQGVREFVAEVVSIGRMRHRNLAQLLGYC
RRKGELLLVYDYMVNGSLDKYLYNRNGMALHWHERYRIIKGVASSLLYLHEEWEQIVIHR
DIKASNVLLDSQMNGRLGDFGLARLYDHGTVAKTTHVVGTMGYLAPELVRTGKATPLTDV
FAFGIFLLEVTCGHRPISIDENNNQVVLVDWVLEHHHNDSVLDVVDRKLLGNFNREEATL
ILKLGLLCSHPLPNTRPSMRKVMQYLDGGQSAPDLSPTYMSYSTMTMMQNEGFDSYISTC
PPSETSILTVSGESSVSALLDGR
Download sequence
Identical sequences I1GT33
15368.BRADI1G23710.1 EG:BRADI1G23710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]