SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G24135.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G24135.1
Domain Number 1 Region: 368-674
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-75
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 30-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.52e-63
Family Legume lectins 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G24135.1   Gene: BRADI1G24135   Transcript: BRADI1G24135.1
Sequence length 760
Comment pep:novel chromosome:Brachy1.0:1:19400280:19402906:-1 gene:BRADI1G24135 transcript:BRADI1G24135.1
Sequence
MGVVSSTIPAALLLTSFLLISKLPRCRPLSFSYNFSDSATYDRADITTEGPATLPQQDDS
PIDLTQNPVPRSQGKCNCWGRASYSKPVPLWDNATGEVTSFTTSFSFVIKAAIDNSTFAP
GDGIAFFLSSHPSKMPPFSGGGYLGLFNQSTPAGTTPPAVVAVEFDTFSNEWDPTINHIG
IDVNSINSIAVLELPAGELAGSEEPMVAWVSYNSSTKLLAVALQLKRSSDGGMARYELNT
TVDLESLLPSEVAIGFSAASGWSVDLHRVLTWSFNSTLAATKMVAVTPQEPRGHNVTEEK
APDISVKQFPSKSIVRPLVGLAVGAMLICVVVVGVLIRFLMVRRRRMSEEHQQEMASADS
DDRCSMDEEFENGTGPRRFRYGELAAATNNFSEDGKLGEGGFGEVYRGSLSDLGLDVAVK
RISKSSQQGRKEYVAEVSIISRLRHRNLVELVGWCHRGGEFLLVYELVPNGSLDARLHGA
SGSSVVLTWPSRYEIALGLGSALLYLHVGCDKCVVHRDVKPSNIMLDASLGAKLGDFGLA
KLLDHGNSLQTAVVAGTRGYVDPEYAASGRASTASDVYSFGIVLLEICCGRVPVLRLPAR
ADQEANDSEYSSLLEWVWGLYGRGAVLEAADHRLNGGEFDQTQVERVLVVGLWCAHPDRG
ARPSIKQALGVLQFEAPLPCLPPKMPVPTYSPTVAAGYSGKRNPAAAGSPAPGDSSSAGA
SSSSFTGGTRSTATSSSTTVGPSSCCPESSVVSMQQTAGM
Download sequence
Identical sequences I1GT93
XP_003560058.1.954 EG:BRADI1G24135.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]