SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G24567.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G24567.1
Domain Number 1 Region: 481-769
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.96e-54
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 2 Region: 46-249
Classification Level Classification E-value
Superfamily L domain-like 7.29e-34
Family Polygalacturonase inhibiting protein PGIP 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G24567.1   Gene: BRADI1G24567   Transcript: BRADI1G24567.1
Sequence length 781
Comment pep:novel chromosome:Brachy1.0:1:19827232:19834232:1 gene:BRADI1G24567 transcript:BRADI1G24567.1
Sequence
MDVRVVMRKSVRSMPVTSLPLIAHAAVLLLLSALPLSQTLTYDQDVFAINGLYTALGSPA
LPGWVANGGDPCTENWQGVTCVMTNITNIKLTGISLAGQLGNTLANFTSLISLDLSNNNI
AGTIPDNLPVTVQQLFLSGNKLSGSIPSTLSTLTLLTAMSLNSNQLAGDIPDVFSSHTGL
ANLDFSANNLTGPLPPSMGNLTALTSLHIQNNQISGTLNVLQDLPLQDLNIENNLFSGPV
PPKLLSIPSFQKDGNPFNTSIAPSPSPLPGAPGPLPSLPPSTGHVPSKEPTKSSGVPNGN
SPTSGANTVRTAKFVGYILVGVVSAVIIVLMVMFCSSKYKERKSKNNVYTKSQIGREPQR
LGEPKIKEVSDIKEHLVKPANTVGKASNTVSNSKEELKVNASKKAPNVVYDAKEATSPLR
AAPGVITKKQKEHVIDMEKTDNFVEEPVHFLQPVAPHTEKAIISASVRTKKGRVPSLGKI
DLKTNVKSFSVASLQQYTNSFSEDNLIRDSRFGKVYQAELPDGEILEVLKIDVDNSRVPV
DVFLELVVNISELSHPNILGLVGYCAEFEQRLLVYEHCSKMTLHDELHYVDEPSNALSWN
ARLQVAVEAAKALQYLHDGCQRPIGHQNFEPSVILLNSTLAVQISECGLALLSQLPGSLR
ALFHYEAPEVHESRSFSDRSDVYSFGVVMLELLTGRKPFDSSRPRAEQHLVRWATPQLYD
IDAISKMVDPCIRGQCSDKALSRFADVISRCIQHEPEFRPPMSEVVQDLTRMISDATKAS
M
Download sequence
Identical sequences I1GTE6
XP_003560082.2.954 XP_014752856.1.954 EG:BRADI1G24567.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]