SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G24920.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G24920.1
Domain Number 1 Region: 272-326,374-464
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000102
Family Protein kinases, catalytic subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G24920.1   Gene: BRADI1G24920   Transcript: BRADI1G24920.1
Sequence length 622
Comment pep:novel chromosome:Brachy1.0:1:20143579:20147751:1 gene:BRADI1G24920 transcript:BRADI1G24920.1
Sequence
MLRLQSIGESRLLAIGTNRRATHFPQSKHGSGYYAIVRDNGLSRKTPSVFSRMFSHYKVI
VRNKVEDHNYRKRISRGYGSLSVALSNSSARQQAQLALKRFSHKYSYTGPRFPLLSRAAC
AISLSLTRSHVIPGVMALAFGKMALSQPVLADSSSHRPKMESIVMKTRDTGQLLSSMVWS
VWEGITLFIRAVHLAFLFFPATALAPFADSFSIEFRRRWLSLVRHTLEKAGPAFIKWGQW
AATRPDLFPSDLCVELAKLHSGAPMHGFAYSKAAIEKAFGRKLAEIFETFEENPVASGSI
AQVHRATLRNQHPGKYVAVKVRHPGVGESIKKDFLLINFMAKVSNVVPGLSWLRLDESVR
QFAVFMMSQVDLSREAGHLHRFIHNFRKWRHVSFPEPLYPLVHPAVLVESFENGESVARF
VDEIEGNARIKKDLAHIGTYAFLKMLLEDNFIHADMHPGNILVRLNESKNKRKRFFRSKP
HIVFLDVGMTAELSTDDRDNLKQFFKAVAIRDGHTAAKCTLQLSKHQNCPDPVAFTEELD
KKFAFWGTPEGDIFHPVECMHQLLDTVRRHKVNIDGNICTVMVTILVLEGWQRKLDPGFD
IMETLKTLLIEKEVKQPPDYFG
Download sequence
Identical sequences I1GTI8
15368.BRADI1G24920.2 EG:BRADI1G24920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]