SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G25180.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G25180.1
Domain Number 1 Region: 514-820
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-83
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 63-161,196-226
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-19
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G25180.1
Domain Number - Region: 359-419
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00306
Family Hairpin loop containing domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G25180.1   Gene: BRADI1G25180   Transcript: BRADI1G25180.1
Sequence length 847
Comment pep:novel chromosome:Brachy1.0:1:20454072:20460337:1 gene:BRADI1G25180 transcript:BRADI1G25180.1
Sequence
MAASPALFALLACLCGALAMAVAASDTLKQGESLTVSATLVSSPAGVFEAGFYAPDPKQP
ARLYLCIWYRGIQPRTVAWVANRANAATGPSPSLTLTAAGELRVLDGAARDDGAPLLWSS
NTTTRAAPRGGYSAVILDTGSFQVRDVDGTEIWDSFWHPSDTMLSGMRISVNAQGKGPAE
RMLFTSWASETDPSPGRYALGLDPVNPNQAYIWRDGNVPVWRSGQWTGLNFVGIPYRPLY
VYGYKQGNDQTLGTYFTYTATNTSLQRFVVTPDGKDVCYMVKKATQEWETVWMQPLNECE
YYATCGSNAICTVVQDRKAKCTCLKGFQPKSPDQWNAGNRSQGCVRNPPLGCQVNQTGDG
FLSIQNVKWPDFSYWVSGVTDEIGCMNSCQQNCSCGAYVYMTTLTGCLHWGSELIDVYQF
QTGGYALNLKLPASELRERHTIWKIATVVSAVVLFLLIVCLFLWWKRGRNIKDAVHTSWR
SRRSSTRSQQSAGMQDITNSIPFDDETEDGKSHELKVLSLDRIKAATSNFSESNKLGEGG
FGPVYLGILPGGEEVAVKRLCKNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQGEEKI
LVYEYMPNKSLDAFIFNSEKQGLLDWRMRFDIIEGIARGLLYLHRDSRLRIVHRDLKASN
ILLDTDMNPKISDFGMARIFGGDENQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYSFGV
LILEIITGKRAVSFHGQQDSLNIAGYAWRQWNEDKCEELIDPSIRSSCSVRQVMRCIHIA
LLCVQDHAQDRPDIPAVILMLSNDSSALAMPRPPTLMLRGRATDSSKSSDEKSHSIGTIS
MTQLHGR
Download sequence
Identical sequences I1GTM1
XP_003562945.1.954 EG:BRADI1G25180.1 15368.BRADI1G25180.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]