SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G25610.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G25610.1
Domain Number 1 Region: 98-210
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.88e-26
Family Protein kinases, catalytic subunit 0.0023
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G25610.1
Domain Number - Region: 212-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0699
Family Protein kinases, catalytic subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G25610.1   Gene: BRADI1G25610   Transcript: BRADI1G25610.1
Sequence length 304
Comment pep:novel chromosome:Brachy1.0:1:20791714:20795086:-1 gene:BRADI1G25610 transcript:BRADI1G25610.1
Sequence
MRAHEAKVGGGSAPAAAGEARVGGKSAPAAEGEAGAGGARATTAVQEGGVQGWGACEAEE
TRGRRRAEMGNGWLCFHGYCSDFRGVRNANGQSTEPKNIESLESMLMDLSTLRAATGGFA
ENNKLGEGGFGAVYKGTLPDGDEIAVKRLSKSSTQGVGELTNELALVAKLQHKNLVRLVG
VCFEQEERLLVYEFVPNRSLDQILFVFDRTQWRILQVWERWADGSVSELVDPAGMGDGFS
RTDALRCVHIGLLCAQGDPAGRPAMSSVVMMLGSGTVSLQAPPKPVSYARSGGGASSGAS
TGSV
Download sequence
Identical sequences I1GTR5
15368.BRADI1G25610.1 EG:BRADI1G25610.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]