SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G26110.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G26110.1
Domain Number - Region: 6-86
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.0575
Family Substrate-binding domain of HMG-CoA reductase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G26110.1   Gene: BRADI1G26110   Transcript: BRADI1G26110.1
Sequence length 122
Comment pep:novel chromosome:Brachy1.0:1:21190360:21195372:1 gene:BRADI1G26110 transcript:BRADI1G26110.1
Sequence
MDDFYITIPYGLIVLGGGVVGYVRRGSVASLAAGAGFGGALLLAGALSIWDFAHGHSNSL
FATVLQTVCAAALTIAMGIRYMKTRKVMPAGIVATISALVLIFYVYKISNGGNEVYIPVS
DE
Download sequence
Identical sequences I1GTX5
15368.BRADI1G26110.1 EG:BRADI1G26110.1 XP_003563017.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]