SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G26900.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G26900.1
Domain Number 1 Region: 943-1250
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-69
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 350-560,608-678
Classification Level Classification E-value
Superfamily L domain-like 3.2e-62
Family Polygalacturonase inhibiting protein PGIP 0.036
Further Details:      
 
Domain Number 3 Region: 588-855
Classification Level Classification E-value
Superfamily L domain-like 1.81e-56
Family Polygalacturonase inhibiting protein PGIP 0.00067
Further Details:      
 
Domain Number 4 Region: 62-368
Classification Level Classification E-value
Superfamily L domain-like 1.87e-56
Family Polygalacturonase inhibiting protein PGIP 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G26900.1   Gene: BRADI1G26900   Transcript: BRADI1G26900.1
Sequence length 1264
Comment pep:novel chromosome:Brachy1.0:1:21981702:21985835:1 gene:BRADI1G26900 transcript:BRADI1G26900.1
Sequence
MARAAPRFSSVMPAAWLLLVVLVSCTAAAAGDDGDVLLDVKAAFSQDPEGVLDGWSADAA
GSLGFCSWSGVTCDAAGLRVSGLNLSGAGLAGPVPSALSRLDALQTIDLSSNRLTGSIPP
ALGRLGRSLEVLMLYSNDLASEIPASIGRLAALQVLRLGDNPRLSGPIPDSLGELSNLTV
LGLASCNLTGAIPRRLFARLSGLTALNLQENSLSGPIPAGIGAIAGLQVISLANNNLTGV
IPPELGSLAELQKLNLGNNTLEGPIPPELGALGELLYLNLMNNSLTGRIPRTLGALSRVR
TLDLSWNMLTGGIPAELGRLTELNFLVLSNNNLTGRIPGELCGDEEAESMMSLEHLMLST
NNLTGEIPGTLSRCRALTQLDLANNSLSGNIPPALGELGNLTDLLLNNNSLSGELPPELF
NLTELGTLALYHNELTGRLPGSIGNLRSLRILYAYENQFTGEIPESIGECSTLQMMDFFG
NQLNGSIPASIGNLSRLTFLHLRQNELSGEIPPELGDCRRLEVLDLADNALSGEIPGTFD
KLQSLEQFMLYNNSLSGAIPDGMFECRNITRVNIAHNRLSGSLVPLCGSARLLSFDATNN
SFQGGIPAQLGRSASLQRVRLGSNALSGPIPPSLGRIAALTLLDVSCNALTGGIPDALSR
CAQLSHVVLNNNRLSGPVPAWLGTLPQLGELTLSTNEFSGAMPVELSNCSKLLKLSLDGN
LINGTVPHEIGRLASLNVLNLARNQLSGPIPATVARLGNLYELNLSQNHLSGRIPPDMGK
LQELQSLLDLSSNDLIGKIPASLGSLSKLEDLNLSHNALVGTVPSQLAGMSSLVQLDLSS
NQLEGRLGDEFSRWPEDAFSDNAALCGNHLRGCGDGVRRGRSALHSASIALVSTAVTLTV
VLLVIVLVLMARRRGRMSGEVNCTGFSSSLGNTNRQLVIKGSARREFRWEAIMEATANLS
DQFAIGSGGSGTVYRAELSTGETVAVKRIASMDSDMLLHDKSFAREIKILGRVRHRHLVK
LLGFLAHGADRGGSMLIYEYMENGSLYDWLHGGGGEGGKKKRALSWDARLKVAAGLVQGV
EYLHHDCVPRVVHRDIKSSNLLLDADMEAHLGDFGLAKAVAENRQGAKECTESASFFAGS
YGYMAPECAYSLKATEKSDVYSTGIVLMELVTGLLPTDKTFGGDVDMVRWVQSRVEAPSQ
ARDQVFDPALKPLAPREESSMAEALEVALRCTRPAPGERPTARQISDLLLHISMDYYRTG
EHKR
Download sequence
Identical sequences I1GU74
XP_003563067.1.954 15368.BRADI1G26900.1 EG:BRADI1G26900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]