SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G27280.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G27280.1
Domain Number 1 Region: 84-164
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000162
Family 2Fe-2S ferredoxin-related 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G27280.1   Gene: BRADI1G27280   Transcript: BRADI1G27280.1
Sequence length 187
Comment pep:novel chromosome:Brachy1.0:1:22362214:22363862:1 gene:BRADI1G27280 transcript:BRADI1G27280.1
Sequence
MAATLQFLSLLAASSSHPAPSCRSEKKSRSVHLPQQQRNRRLRVIRAVETDEPSVAAPPE
EEPPSVDFAFVSPRLLPDGTPDVHYRTACGGQKLRDIMLQGHIDLYGPYDKFLLNCSGGG
ECGTCIVEVVEGGEMLSPKNEVEKEKLRRKPKTWRLACQATVGKPDSRGQMVIQQLPEWK
VHEWDRQ
Download sequence
Identical sequences I1GUC3
XP_003563100.1.954 EG:BRADI1G27280.1 15368.BRADI1G27280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]