SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G27377.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G27377.2
Domain Number 1 Region: 519-747
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-46
Family ABC transporter ATPase domain-like 0.00000536
Further Details:      
 
Domain Number 2 Region: 180-505
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.45e-45
Family DNA repair protein MutS, domain III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G27377.2   Gene: BRADI1G27377   Transcript: BRADI1G27377.2
Sequence length 811
Comment pep:novel chromosome:Brachy1.0:1:22434385:22447642:-1 gene:BRADI1G27377 transcript:BRADI1G27377.2
Sequence
MKEDATGSGGGGRVVGVGDRSSFVIGLIENRAKEVGVAAFDLRSASLHLSQYIETSCSYH
NTKTLLHFYDPMVVIVPPNKTAADGMVGVSELVDKNYPANKKVTVARGCFDDTKGAVMVK
NLSARDPSALGLDTYCKQYYLCLAAASATIKWIESEKGVIITSHSLSVTFNGSFDHMNID
STSVQTLEIIDPLHTELWGTSNKKKSLFQMLKTTKTTGGCRLLRANLLQPLKDIQTINTR
LDCLDELMSNEELFFGLTQGLRKFPKESDKVLCHFCFKPKKITDEIPKPANGRKSQLLIS
DIIVLKTALDAIPFLSKVLKGAKSFLLQNIYQTVCENPKYARMRKRIGDVIDEDAVHSRA
PFAACTQQCFAIKAGIDGLLDVARRSFCDTSEAIHNLATKYREECQLPNLKIPYNNRLGF
YFIIPQKDITGKLPSKFIQVVRHGKNVHCSSFELASLNARNKSAAAECFLRTELCLEGLI
SEIREDIGILTLLAEVLCLLDMIVNSFANTISTKPVDRYTRPEFTDDGPMAINAGRHPIL
EGLHTDFVPNNIFLSEASNMVLVMGPNMSGKSTYLQQICLIVILAQVGCYVPAQFASLRV
VDRIFTRIGTGDNVENNSSTFMTEMKETAFIMQNVSSKSLVVVDELGRATSSSDGLAIAW
SCCEHLLSLKAYTVFATHMEGLSELATMYPNVKTLHFEVNLRNNRLDFKFQLKDGLRRVP
HYGLLLARVAGLPASVVDTATNITSRITEQEMVRMDANCEQYRPLQMAYQAAQRLICLKY
SNQGDEYIREALQDLKESYAAGKLTRKKEMR
Download sequence
Identical sequences I1GUD4
EG:BRADI1G27377.2 XP_003563107.2.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]