SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G28950.6 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G28950.6
Domain Number 1 Region: 934-1079
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.52e-41
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 183-272
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.88e-22
Family PB1 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G28950.6   Gene: BRADI1G28950   Transcript: BRADI1G28950.6
Sequence length 1091
Comment pep:novel chromosome:Brachy1.0:1:24311845:24322003:-1 gene:BRADI1G28950 transcript:BRADI1G28950.6
Sequence
MEPRKDDVLSKAQSTVHGSPSSSSASTSSPVPEYPATSTTKPVLNFSIQTGEEFALEFMR
DRAISKKHLVPVMPRDQNAASVADLKSSRGILGAHRTGAESRFDASIFLTTDNQQPDELE
RRSFAENENRSRHISTRSVPRAPSSGGSSHGLAHGYASSGASDTSRRIKILCSFGGKILP
RPSDGKLRYAGGETHIIRISRNISWQELKQKTTAIFNQPHIIKYQLPGEDLDALISVSND
EDLRNMMEECGFLDSGEGSQKLRIFLVSSIDFDDMNFSLGSMDSDSGIQYVVAINGMDVG
AAKTSSGHGLVNTSINEFGQFINFNVDSTPADLRKTGSNLHSLNESTSVPPAIMSRPVPV
GLSSDNTATLHSYPNHGIQHVHGSDFSYPTSSEQFHDSEGQMSIPLSTPSDFRYTSQYAP
YSGTASLQSFEQQSYQDGMAVGSVKKEKRDSVKMPLQNNGLDYFRSLENLSAPMLDHESS
ALKYMHSELPATSSVQEGLASSVHPSYSVKSLETYTASKTMSPTQASECNEDDRQSSEAF
ASGCSEFQVDMSDHSNKNSPPHPGRVFHSEWIPREQAGFLNRLSKSDDPLNSQILILQSQ
SGVANESIAEAIDPAVEGTEKSNLATWALNLNDPITDDSLIQFGKEYVNTVQQTSPFNEQ
LFGETMSSNDTCMHVAEKIVVKGKVTEATTDGIEATNLRGDQVAMPHSWDAPKPAFSTDV
ESDPVVSCSTSTVDDSRKEHIIPKTHDKDVAGCTGPTGERSSPDILSDFFAKANTAAQSP
HPLNDPILSLNMPNYEPQRWSFFRNLAQNEFQHKDRDKDLAKIEEGSYPFAHLEHDMVNV
KNFPPQDVIHVGTHSVPSSTNVDSTILPPTFIPSQTDNPPMMKTVEGFQVDNPFTNMREM
IPSVPEFEEPKFEESRAVGPVMDASFVDNDFEYLQIIKNEDLEELRELGSGTFGTVYHGK
WRGSDVAIKRIKKSCFTGRSSELERLANEFWREAEILSKLHHPNVVAFYGVVKDGPGGTL
ATVTEFMVNGSLRHVLQRNKNLDRRKRLIIAMDAAFGLEYLHSKNIVHFDLKCDNLLVNL
KDQSRPICKVV
Download sequence
Identical sequences I1GUW4
EG:BRADI1G28950.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]