SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G29340.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G29340.2
Domain Number - Region: 121-199
Classification Level Classification E-value
Superfamily PH domain-like 0.00018
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G29340.2   Gene: BRADI1G29340   Transcript: BRADI1G29340.2
Sequence length 583
Comment pep:novel chromosome:Brachy1.0:1:24828179:24832230:1 gene:BRADI1G29340 transcript:BRADI1G29340.2
Sequence
MAAVAVFLSGFLLGLLFLSLAEGAALVWALRTLRRRGPRPPEAATAAVQLSGDRPLTTEK
QGFLWMLEPQKMPNVSSSNQLPNGVQKDTKDKKNIVEVFPIRMLAKIDGHSLILSGPDGS
RITIELMNCSAVAVSASNLPSRKWAKRYPIKLESKGSEICKGSKVCYLYVDTSWEKESWC
KALRLASSTDKEKLNLRARLSEEFRSYISSLNAGYPCFLKSSALNAEDHAIMDKVVKSDG
SSKVRLLLKKLARKASGKSPQVTRTSSISAQAERNGWDKIRSNRGSSLIDAPEERSSSSS
SSQGTNQPSTPSSDFGHSNVFSDSPDANIDEKCADGGTLCWNLLISRFFFDAKMSDEIRK
AIKARIQRTLSNMRTAAYIGEITLTDLSLGELPPYLRRMRVLPRDLNELWAFEVDFEYCS
GIVLHIEARLEVQEPELQKDIMKTTLGADSNGSIDSELMENIEHYGNQFRSPQLLAPVVE
DEDDTDVLRRSKSTGWTSAYTSRWKNILHSITDHVSQSLNGNWSLLSGTERSPTATLHRL
SATESRLRFIKAWCCRIVKVFPCHGWYRRRMTGYLAKLHPLYG
Download sequence
Identical sequences I1GV12
EG:BRADI1G29340.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]