SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G29930.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G29930.1
Domain Number 1 Region: 293-365
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.2e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 152-212
Classification Level Classification E-value
Superfamily PH domain-like 0.0000138
Family Phosphotyrosine-binding domain (PTB) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G29930.1   Gene: BRADI1G29930   Transcript: BRADI1G29930.1
Sequence length 446
Comment pep:novel chromosome:Brachy1.0:1:25416120:25421532:1 gene:BRADI1G29930 transcript:BRADI1G29930.1
Sequence
MHPAGAGAGDYSSSYYPPYPAPTSAPQPPPTYHHPTASASAPPYSPYPTNFADPAAYPSY
PPAPTPPADHLPHYAPPPPADHLPHHYAPPPAAPPAPQPYYPYEPPPLPSPHNPSPSPYP
SEGEGAAAGVAASPKLLRAVPKAETSEDVRVGVQKFRVKLLPEGGGSPMDVLCQVGLDGI
RMLDPNTSRTLRIYPLETVTRWDVLDSSIFAFWSKSSVDLEARRIRLKSNSYTTNTILDT
VTAATVQFKEMGGSSMSRSKAIADAAIPSEQQDKRKNFLDWRNLMKPINEEKDHWVPDEA
VNKCTACAGDFSAFNRRHHCRNCGDIFCDKCTQGRTPLTSDADSQPVRVCDRCMTEVSRR
LNSAKEAANRPIVHSHEDLAKKLQEAMDINKKSSSASRPSDGSSGKRMREVACPICTVHL
QVQVPSSGSETIECGVCQHPFLISSR
Download sequence
Identical sequences I1GV88
EG:BRADI1G29930.1 15368.BRADI1G29930.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]