SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G30007.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G30007.1
Domain Number 1 Region: 2302-2445,2480-2618
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-79
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0032
Further Details:      
 
Domain Number 2 Region: 288-380,483-554,601-668,728-997,1034-1079,1112-1363,1466-1573
Classification Level Classification E-value
Superfamily ARM repeat 1.51e-21
Family HEAT repeat 0.083
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G30007.1
Domain Number - Region: 2171-2284
Classification Level Classification E-value
Superfamily ARM repeat 0.00345
Family Armadillo repeat 0.065
Further Details:      
 
Domain Number - Region: 1624-1653,1706-1779
Classification Level Classification E-value
Superfamily TPR-like 0.0159
Family Tetratricopeptide repeat (TPR) 0.074
Further Details:      
 
Domain Number - Region: 1924-2072
Classification Level Classification E-value
Superfamily TPR-like 0.0885
Family BTAD-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G30007.1   Gene: BRADI1G30007   Transcript: BRADI1G30007.1
Sequence length 2686
Comment pep:novel chromosome:Brachy1.0:1:25455526:25467672:-1 gene:BRADI1G30007 transcript:BRADI1G30007.1
Sequence
MSTFARYTKELRELIAGSSTTGPSSVHYEDKLREVLSILLRDHVLPSPTDAANKRETTVV
LKLLDYTARRNPGVFFNGRAAEVIRVIGRIFPFFADPDFGCVSQRETYGGRSHSTRFGLF
SHFSAQVTEKPTGNVLYVASKRAEKPCGVLSRCLVKCLCGSFSDILEFPGFFSELPDSCQ
PKNGPGVLVDLTGDMRWRPFVTSLITLINKCLTDGTLYVEGLVSMQFVSSACSILCYGDE
SLHKVCFDFARIVATVMKVEILPMETIIRSITCILNQDVDDLSMFRDADYDFSMGACLHA
LHSSCPACIVESTAVDIVNVFASAMQTSKSSELQAAMCSAYKRIVKVCSPLVWKPEILLK
LLYLPKPYDKLIECIRLVVDKFGRSFICVDDNDDQNSFLRKSEGFELPKAGQKRIAQNQE
NNSSKRQKMSESRFSVGSFITTEFSAGIGYEVANDYAYDFRLSVESHIKFLSPDNHKAYP
LEPDIAIQVLSLLCLSFGVNPETGLFIRISKQVLSWIPWICKQATKKCLFSFDISLYLEA
LHVVMLLQSFHPGDIKLLGNDAQLIGESSADLIHSIYVDLISLVKWVWSDGHVSAEACSD
WKLKCLLVQVIATISNRLNAECDLEVLELAMHSETVEVQNEALMSLPIIVLYSGPRMLGV
MFRKLESVGTLGLEKVWKSIAFSLGFLSCLNGNTNATDKVGNHCKLFLDKHFRQPVSTSD
LLLRGFRCPRCDIRAVHTKEQLSVVDIAVLQDENVDFKLNMSKAHFLFFKFLYADTSKEC
TISMVEVLPRILRHSSREVLLATKIEWVKCIDFLLLHGLKAVRDAFSGVVSCFLENSVMD
ILFSDGLGMNGGTKELNFLDKIKHAFTEAEDSHVLLTLLESTATIMKASDTQGEVFFGSF
VLLIAQLDNHDHIIKMATSRLLHRCCIYCFEGGIEVFLSKHFRVRDNLYDYLSSRLLTHP
RMISEFAEAIIGVKTEELIRRMVPSVIPKLIVSHPNNDQVVITLDELANHLNTGLVPLIV
NQLPKVLSFTLFYEDGQHLPSVLQFYHTETGTDTKEIFAAALPALLDEIVCFPGESDQTE
TDRRTTRISPTIQNIARILTGNDTLPEFLKNDFVRLLNSIDKKMLRSDDTKLQKLALQRI
RKLVEMMGPYLSTHAPKIMVLLIFSIDKEALQMDGLDVLHFFIKQLTEVSPTSIKYVMSQ
VVAAFIPSLERCRECPFAHLSKIVEILEELVLKNSILLKQHIRELPLLPSLPSLSGVNKV
IQEARGIMTLQDHLKDAVDGLNHESLNVRYMVACELSKLLKTRREDITALIIGEDVADLD
RLKLVCADCLGALGAVDPAKFKVISSERFKIECSDDDLIFELIHKHLARAFRAASDTMVQ
DSAAFAIQELLKLAGCQSLPNEDNGNDPSSCETSKRGQKLWGRFSGYVKEIIAPCLTSRF
QLPNVNDAALPSSIYRPTMSFRRWLYYWIRKLTSHATGSRCGIFSACRGIIRYDMPTALY
LLPYLVLNVVCYGTPEARQSITEEILSVLNAAASESSEAIVHGITQGQSEVCIQAIFTLL
DNLGQWVDDLKQEIALSQPSHVMAGKEAGKSKEENHSHSIYVQDQLLVQCSNVAELLAAI
PKVTLAKTSFRCQAYARALTYFESHVREKSGSSNPAAECSGTFSDDDISFLMEIYGGLDE
PDGLLGLANLRKSSNLQDQLIINEKAGNWAEVLTLSEQALQMEPDSVHRHCDVLNCFLNM
CHLQAMVAHVDGLVYRIPQYKKTWCMQGVQAAWRLGRWDLMDEYLPEADKGLVCSTSENN
ASFDMGLAKIFKAMMNKDQYMVAEKIAQSKQALLVPLAAAGMDSYMRAYPYVVKLHMLCE
LEDFNTLLGDESFLDKSFRADDPNFLKLTTDWENRLRCTQSSLWAREPLLAFRRMVYNLS
HMNAQVGNCWLQYAKLCRLAGHYETAHHAILEADASGAPNAHMEKAKHLWNIRKSDSAIA
ELQQTLLNMPAEVLGNAVLSSLCSLSLALPNAPVSATQASKENPDVSKTLLLYTRWIHNT
GQKQSEDIKSHYNRVTELRPKWEKGFFCMAKFLDDLLVDARKRQEDKRFTSGVVAVPPSS
AGSSKAPAEEKPWWDSLPTVALCYAKGLHKGHKNLFQALPRLLTLWFEFGNIYNQASSDA
MKNIHHRMIGIMRGCLKDLPTYQWLTVLSQLISRICHQNAEVVKSVKRIITSVLQAYPQQ
ALWMMAALSKSTVSARRDAAAEILQSAKKSCRRGSDNGALFVQFPSLIEHLIKLCFHPGQ
PKARAINISTEFSALKRMMPLGIILPVQQALTVTLPSYDSNMSDQSSFHPFSVSEHPTIA
GIADDAEILSSLQKPKKVVFLGSDGVPRPFLCKPKDDLRKDARMMEFNAMINRLLSKVPE
SRRRKLYIRTFAVVPLTEDCGMVEWVPNTRGLRQILQDIYITCGKYDRVKTNAHIKRIYD
VCHASKIHEDVMLKTKILPMFPPVFHKWFLMTFSEPAAWFRARVAYAHTTAVWSMVGHIV
GLGDRHGENILFDSTTGDCVHVDFSCLFDKGLQLEKPEVVPFRLTQNMIDGLGIAGYEGV
FLKVCEITLSVLRTHKEALMTVLETFIHDPLVEWTKSHKSSGVEVRNPHAQRAISNITER
LQGVVVGVNAAPSLPLSVEGQARRLIAEAVSHKNLGKMYIWWMPWF
Download sequence
Identical sequences I1GV96
EG:BRADI1G30007.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]