SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G30180.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G30180.2
Domain Number 1 Region: 131-174,216-297
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.25e-34
Family Pseudouridine synthase RsuA/RluD 0.0002
Further Details:      
 
Domain Number 2 Region: 69-123
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000687
Family Ribosomal protein S4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G30180.2   Gene: BRADI1G30180   Transcript: BRADI1G30180.2
Sequence length 309
Comment pep:novel chromosome:Brachy1.0:1:25563510:25567220:-1 gene:BRADI1G30180 transcript:BRADI1G30180.2
Sequence
MAAAATAAAPAVAAAVSTLLRRNTALRASRPRCLSADANVEALPAPSRRGGHAGTRLEEA
VPAGEGRSRVDAWISARLGGGGVSRARVQASIRAGLVAVNGRPVSKVSQTVKGGDTVSCT
VSELQPLRAEAEDIPLDIVYEDEHLLVVNKPAHMVVHPAPGNANGTLVNAILHHCKISTF
TCLARNSIDDECPESSDDDIDVFDVDQFNGEVSSEVRDAIVRPGIVHRLDKGTSGLLVVA
KDEHSHAQLAEQFKLHTIRRIYISLTCGVPNPNSARIEVPISRDPNNRIRMIAAPGSGHR
YARHAASIK
Download sequence
Identical sequences I1GVB4
EG:BRADI1G30180.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]