SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G30870.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G30870.1
Domain Number 1 Region: 184-246
Classification Level Classification E-value
Superfamily WRKY DNA-binding domain 4.71e-25
Family WRKY DNA-binding domain 0.00017
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G30870.1
Domain Number - Region: 71-157
Classification Level Classification E-value
Superfamily Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) 0.0811
Family Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G30870.1   Gene: BRADI1G30870   Transcript: BRADI1G30870.1
Sequence length 326
Comment pep:novel chromosome:Brachy1.0:1:26329079:26330580:1 gene:BRADI1G30870 transcript:BRADI1G30870.1
Sequence
MDEQWATTGQQPSLSLGLTVGAVPMRRAAAPAATTRVLVEEDFMSVKKGNHEVEALEAEL
RRVGEENRRLGEMLRALVHKYADLQAKVTAMAAAAAVQAEANNNNHQQSSTTASEEGGGS
AASPSRNKRVRSDDGSGAGAGFVTVAAVADHTECTSAAAAVKVNSGSKVSRRFVHADPAD
LSLVVKDGYQWRKYGQKVTKDNPCPRAYFRCSFAPACPVKKKVQRSADDKALLVATYEGD
HNHAQPLATGTAAKNSASKPAPPLGLQEQQRKQQQEAAAMAAERETAERKNLAEQMAATL
TRDPGFKAALVSALSGRILELSPANN
Download sequence
Identical sequences I1GVK0
15368.BRADI1G30870.1 EG:BRADI1G30870.1 XP_003563320.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]