SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G31290.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G31290.1
Domain Number 1 Region: 22-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-75
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G31290.1   Gene: BRADI1G31290   Transcript: BRADI1G31290.1
Sequence length 429
Comment pep:novel chromosome:Brachy1.0:1:26750546:26752329:-1 gene:BRADI1G31290 transcript:BRADI1G31290.1
Sequence
MGSAASCCCGSEKVEHGCVSTSSVGNTTWRIFSYKELHAATGGFSEENKLGEGGFGSVYW
GKTPDGLQIAVKKLKPNTNTSKAEMEFAVEVEVLARVRHRNLLGLRGYCAGSAAGADQRM
IVYDYMPNLSLLSHLHGQFAADNTLDWARRMRVIMGSAEALVHLHHEASPAIIHRDIKAS
NVLLDSDFAPLVADFGFAKLVPDGVSHMTTRVKGTLGYLAPEYAMWGKVSGACDVYSFGI
LMIELVSGRKPIERLPSGAKRTITEWAEPLIARGRLGDLVDPRLRGSFDGAQLAQVLEAA
ALCVQGEPERRPDMRAVVRILRGEPGDDAAGKGGNNKPVRLESVKYADHLMETEVDSVYS
GEEDENEEEEDEEEDAMEQSSDEVEEYSLMMDDRSSANFGVFGAMPVPAQTMVRDTYVRR
FGGNNAVKI
Download sequence
Identical sequences I1GVP8
15368.BRADI1G31290.1 EG:BRADI1G31290.1 XP_003563351.1.954 XP_014756643.1.954 XP_014756645.1.954 XP_014756647.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]