SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G31737.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G31737.2
Domain Number 1 Region: 114-406
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.59e-46
Family Pseudouridine synthase I TruA 0.00047
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G31737.2
Domain Number - Region: 12-65
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 0.0191
Family Holo-(acyl carrier protein) synthase ACPS 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G31737.2   Gene: BRADI1G31737   Transcript: BRADI1G31737.2
Sequence length 410
Comment pep:novel chromosome:Brachy1.0:1:27209132:27213043:-1 gene:BRADI1G31737 transcript:BRADI1G31737.2
Sequence
MATAAKAKPPSALSVSTAAERDEYPQYNHTDACRHLRWTAKESYEYMHARPWSRVVDFYA
MLVRTGAGTAGLAEMFRKDEKDHISGTDGEDFETSSEKQMAVASSKARGGRWERLNFKIV
LSYHGGSFDGWQKQPDLNTVQGLVEKHLGQFVDERKAKQLQERSLPIEGCATVAGRTDKG
VTALQQVCSFYTWRNDVKPSDIKDTINEAAPDKLKSLFVSEVSRQFHPNFSAKWRKYLYI
FPLDQDAEPISGKELSSIILENPEYNVTCRSFDVAKVDKIIRKLEGKLLSYKIFARDTQA
SRSDGPATECFMFHSRAAVSKLYSADENFKEGTKVMCIELVADRFLRKMVRVLVATAIRE
AAAGAEDDVLLNLMEATCRRATAPPAPAEGLCLADVGYEDFNKHKCFIVD
Download sequence
Identical sequences I1GVV0
EG:BRADI1G31737.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]