SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G32520.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G32520.1
Domain Number 1 Region: 1315-1608
Classification Level Classification E-value
Superfamily BEACH domain 6.02e-124
Family BEACH domain 0.00000000975
Further Details:      
 
Domain Number 2 Region: 1715-1975
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.92e-38
Family WD40-repeat 0.0079
Further Details:      
 
Domain Number 3 Region: 1152-1194,1232-1296
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-19
Family PreBEACH PH-like domain 0.0081
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G32520.1
Domain Number - Region: 46-95
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00538
Family Leech intramolecular trans-sialidase, N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G32520.1   Gene: BRADI1G32520   Transcript: BRADI1G32520.1
Sequence length 1991
Comment pep:novel chromosome:Brachy1.0:1:27885492:27900624:1 gene:BRADI1G32520 transcript:BRADI1G32520.1
Sequence
MTMTPVDVLGASGAGDGASRKVVQCSEISSTRYAKVNEVMTRCTIGTQLIPVGEEPLSIG
FERTFAFTGQMGPVYVFSDALSSEQIKGIYNLGPSYMYSFHGDDSLYRGILDARDGISSK
IIFGLNAQASESKTLFSVSSALDSADKSTVEATIIGGTKLCSRRLPQDIIYCVGGVSVFF
PLFTQFCDVVSCHTSVIDDKLAAEVIELVASVLDGNVSNQQQMYLLSGLSILGFLLQAAT
PQLLNMKTLPAMKYMFDVLRNCGMSKVLLKDAISQVYLNPEIWLYASYEVQRDLYMFLIQ
YFETDGRFLPLLCGLPRVIDIVRQYYWEKIDSRYVVGSKPLLHPITKQVIGERPKIEEIR
KLRLLLLSLAEMSIKLKVSPDDIQALVSFSERSQDIACIEDILNMIIHALSHSSLLSSFL
EHDIPQVTEKEQRNRLCEPRSRVIVEDSENTEFEPIRLLGLQLLGKLLVGIPSENKEATL
FTSPIGQSRPFSENLRKEIASAPQLFFDTISERLLKFPLSDNLCATLFNVLLGGTSPKQV
LQEHLQSDPSKDRNCNPSSLVYFSVPQILEHGWNSWLETSTNLDVIKDHKSVSKGKLDNV
EINELIQGQLSSSYFLRDILDDIVGSLLQTSLEENIFLSQPCCDNVLHLLKLIQELLVNQ
IGIKLLFPSPSTTEESSSDDKWKNDIKFALNEILNAESNGHYRSFPWRSCQFADGDEISE
DWWSFFDKVWNIICDLNGKGPSKLVPKSPNVGVPSLGQRARGLVESLNVPAAEMAAVVVS
GGIGTALGAKMNIFADRATLLREEILPRIFFHLVILYLCKAGLENASKCVLQFMSLLPVL
IAEDELSKNTLHFLIWSLLIVRSQYGQLDDGARFHVLSHLILETIIYGKSMLVTNILGRD
DSMDINSNQEAGFILSFIQKDRVLATAIYEVKHMKSVQADRLRQLQELHSKLNECSTKET
QLVQIINEQIHLSVSSAVSADDSRKTAFLLAFDEDQQIVADKWIHIFRALIDERGPWSAN
PFPNDVVTHWKLDKTEDKWRRRFKLKRNYMFDERLCQPSCSRIENAEPSVDLPSFSTKIP
EKMRRFLLKGVRGITEDSGYGPSEDTNDMSESSHSPSERQNQNNAADSSDYRNNVQNKRE
ASSTNVDNDYSKVLCSVHCVLVTPKRKLAGQLNITRTVLHFSFGFLVEGTGGSSVFSKFK
DEKDSDGKNEMGGAERLYGCRDSLIRINGGLMQNQSNKIKHHRRWNITKIKGVHWTRYLL
QYSAMEIFFDDSNAPIFLNFSSQKDAKSAGSLLVSLRNDALFPKGSIKDKNSVISFVDRR
VALEMADNAKERWRRREISNFEYLMILNTLAGRSYNDLTQYPIYPWVLADYTSEKLDFNK
SSTFRDLSKPVGALDEKRFKVFEDRYLNFCDPDIPSFYYGSHYSSMGIVLHYLLRLEPFT
TLHRSLQGGKFDHADRLFQSIDGAYRNSLSNTSDVKELIPEFFYMPEFLENSNSYHLGVK
QDGEPLGDVALPPWAKGSPEEFIHINREALESEYVSSNLHHWIDLVFGYKQRGQPAVEAA
NIFYYVTYEGAVDLENMDDMLQKYAIEDQIANFGQTPIQIFRVKHPRRGPPIPIAHPLYF
APQSITLTSSISSTASHMSAVLFIGLLDNTVILMNEGLVLSVKLWLPTRLQSGGNFTFSG
TQENLCGIGSDIISPRKIGTFLAENVKFGRQFLATMQINSDKYLILCGNWENSFQIISLC
DGRIVQSIRQHKDVVGCVAVSSDGNVVATGSYDTTVMIWHVFRGRPSEKKFRPTNLELSE
NDHVIMERPVHILCGHDDIITCLFVSTELDIVISGSKDGTCIFHTLREGRYVRSIRHPSG
IGLSKLVASRHGRVVFYSESDLSLHMHSINGKHIASSASNGRLNCMELSCCGEFMVCAGE
HGQIVLRSMHSLDIVWKYDGAGKTITSLAVTPEECFLAGTKDGSLLVFSIETPLLRRGSM
PRTRPKPSATG
Download sequence
Identical sequences I1GW37
15368.BRADI1G32520.1 EG:BRADI1G32520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]