SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G33650.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G33650.1
Domain Number 1 Region: 489-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-72
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 61-156,188-220
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-29
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G33650.1
Domain Number - Region: 354-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000255
Family Pan module (APPLE domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G33650.1   Gene: BRADI1G33650   Transcript: BRADI1G33650.1
Sequence length 801
Comment pep:novel chromosome:Brachy1.0:1:29218405:29221003:1 gene:BRADI1G33650 transcript:BRADI1G33650.1
Sequence
MHLLIVFTLLFFPRIPASSYATDTILAGQALAVNDKLISKNGRYALGFFETSRKSSKSTT
NWYLGIWFNTVPKFTSAWVANRDRPIKNSTSLALTISHDGNLIILNQSTESIIWSTQVKM
AKNSTTAMLQSDGNFILANSSNSSQVLWQSFDHPTDTFFPGAKLGWNKVTGLNRRLVSSK
NLINPASGVYCTELDPSGVNQFWLAPLNSSVPYWSSGKWNGEYFASIPEMAGKAVFNSKF
VDNDQEKYYTYNLKDENMISWQVQDVSGQSKLFIWIKGSQEWVMIYRQPKDLCDVYAICG
PFTICNGNALTYCNCIEGFTITSPEDWDLEDRTGGCSRNTPLDCIRNKSTTHTTDKFYSV
PCVKLPQNPRKVKAAANTSMCAQVCLNRCSCTAYSFSDGRCLIWHNEMLNIRTVQFSDTT
NSTGETLYLRISAKEVQSSKNNRRGIVIEVVIGTGVSVLGLLALILALMIWRNKKKSSDR
ILNGSQVCNGLIAFKYNDLQGATKRFEDNLGAGSFGSVFKGFIDDSIAIAVKRLDGAYQG
EKQFRAEVSSIGAVQHINLVKLVGFCCEGSKRLLVYEYMSNRSLDVHLFRSNSAMVNWTA
RYQIALGVARGLTYLHESCRDCIIHCDIKPENILLDASFHPKIADFGMAKLLGRNFSRVV
TTMRGTAGYLAPEWIAGVATPKVDVYSYGMVLLEIISGKRNSNASCSSGGDLDIYFPVHA
ARKLLEGDMRSLVDQRLHGDVNLDEAELACKVACWCIQDDDLDRPTMGQVVQILEGLVEI
RMPPIPRLLQAMAGTSHSVCS
Download sequence
Identical sequences I1GWH7
15368.BRADI1G33650.1 EG:BRADI1G33650.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]