SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G34190.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G34190.2
Domain Number 1 Region: 487-774,839-897
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.25e-60
Family beta-Lactamase/D-ala carboxypeptidase 0.00069
Further Details:      
 
Domain Number 2 Region: 91-154,192-317
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.55e-22
Family Protein kinases, catalytic subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G34190.2   Gene: BRADI1G34190   Transcript: BRADI1G34190.2
Sequence length 940
Comment pep:novel chromosome:Brachy1.0:1:29804874:29812061:-1 gene:BRADI1G34190 transcript:BRADI1G34190.2
Sequence
MGWGTILSRRLKVFSLALFVYLDYKAVQKRVQWVSTVKKNAIWAKTHERNARRVLSLMIE
LEGLWVKMGQYLSTRADVLPEPYINVLKQLQDSLPPRPLEEVRGTIEKELGKPMGELFAS
FDIDPLATASIAQVHRATLENGREVVVKIQHDGIKEIILEDLKNAKSLIEWIAWAEPQYD
FNPMIDEWCKEAPKELDFNHEAENTRTVSKNLSQKTEIGSGSVSSAVDVLIPEVIQSTDR
ILILQYMDGIRLHDNDSLEAYGVDKKKLVEEITRAYAHQIYIDGFFNGDPHPGNFLVSKE
PPHKPILLDFGLTKRISESMKQALAKMFLSCAEGDQVALLSAFAEMGLKLRVDMPQQSME
IASIFFRQSTTAIEAKENIKALNEQRERNAKALQEKMKLSKKEVKHFNPVDAFPGDAIIF
MRVLNLLRGLSASLNVRIVYLDIMRPFAESTLLGNVMRGPSTNTQWIYDSYPNSEVESKL
RNLLLEMGSDKILGIQVCAYKDGKVIIDTAAGSLGKYDPRPVQPDSLFPVFSVTKGITAG
MVHWLVDKGKLKYDETVADIWPKFGTNRKELIKVHHLLNHTSGLHNALGDVVKTDPLLVC
DWEETLQKIAKCTPETEPGSSQIYHYLSFGWLCGGLVEHASGKKFQEILEEAIVHPLQIE
GELYIGIPPGVESRLAALTVDVEELQKLSGFRPGPDVPPELVSSIAQMASGVPALFNTLN
VRRAIIPAANGHCSARALARYYAALAAGGAIPPPHSGNSKPPLGSHLHTPMFPTAEPKKK
KKGSTKKGGSSPEKGEYAQLRTSDADSEVLTAAVTGSASTMFANSDILDAFMGIGDYSGM
IYPNGKFGLGFRRYGRSGSAPMGFGHSGMGGSTGFCDPEHGFAIAVTVNRMSLGSSTRRV
VRFVCEELGVPVPDEFSVSGEKGPDMVLNLAPPAPESNPM
Download sequence
Identical sequences I1GWP3
XP_003563512.1.954 EG:BRADI1G34190.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]