SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G34880.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G34880.1
Domain Number - Region: 185-284
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0173
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 
Domain Number - Region: 32-66
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.029
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G34880.1   Gene: BRADI1G34880   Transcript: BRADI1G34880.1
Sequence length 321
Comment pep:novel chromosome:Brachy1.0:1:30423581:30425341:-1 gene:BRADI1G34880 transcript:BRADI1G34880.1
Sequence
MVSWSDASSSDNSLRRDYSDVCPDWMYDSDFPGEDKKIHCHHGLCGSRRVAIRGEQTGRR
YIWCSNIIQDCGFVHWVDPEWPNPMKKRLLHLWSNYELGQNCQREIENAGISDAERRKAM
EEKMKVEQMDFKAVEEKKQADFALMKVEEERKKAVEMKMRLELQLADIETEAKLKVRRLR
QLALEKEKWLMLAWTSFSYLGALYLGAVNGTLEACLGDLLGAGAGAAVALLAAADLVVAG
AGTGVAAAGAGADVVLLAAAYAFLGDLLGGATSALGACLGDLLGGGAEAVGACLGDVLGG
GVEVAGACLGDSSLGDCGCST
Download sequence
Identical sequences I1GWX9
EG:BRADI1G34880.1 15368.BRADI1G34880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]