SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G35310.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G35310.1
Domain Number 1 Region: 525-828
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.26e-58
Family Protein kinases, catalytic subunit 0.00035
Further Details:      
 
Domain Number 2 Region: 76-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.77e-25
Family alpha-D-mannose-specific plant lectins 0.0016
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G35310.1
Domain Number - Region: 370-402
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0192
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G35310.1   Gene: BRADI1G35310   Transcript: BRADI1G35310.1
Sequence length 854
Comment pep:novel chromosome:Brachy1.0:1:30793707:30796271:1 gene:BRADI1G35310 transcript:BRADI1G35310.1
Sequence
MRALTVLTTPAAFLLMITTATTLRLALAASDDDNQHRRSSILWRGSYLSVGDDALVSPNG
AFSCGFHRVATNAYAFAIWYTAPAAVVPTLAWTANRDAPVNGMGSRAELRGDDGSLVLQD
FDGQAVWSTNTTSTTGAGAERAQLLDTGNLVVSDAEGRTLWQSFDWPTDTLLPGQPITRY
RPLVSAKARGSTYSGYYSFYFDSYNVLNLMYDGPEININYWPDPFKTWYDNKRMAFNSTR
QGRLDERGRFTASDNLRFNASDYGDAGVLRRLTLDYDGNLRVHSLVDASRGTWRATWAAL
PRLCDVHGICGRYGVCTYEPSSGAAACSCPEGFVPSDPGDWSKGCRRAYGDVVCGEDVFF
AELPHVDYWGFDYNMTSGVTFETCREICLDDCNCQAFGYKKGGTGKCYSKVGMWNGRGPD
AKQFIYFKIPTRVQKDLNLSSSSVLRLIFDGHACDTRERDASIGTGIGSRYLRNSGGGKI
NFVYFYSFLAGLFVVEAVFILIGYIFIFVLADPAASRRVHDEEGYSLVLSNFRRFEYDEL
SHATCDFAEELGKTVYKGVLADGRDVAVTRLAEAADEVFRSELSVIGRINHMNLVKIWGF
CSEGSHRLLVCEYVENGSLAEAHFGAEKETPLAWHSRYKIAVGAAKGLAYLHHECLEWIL
HCDVKPENILLDADLEPKITGLGLVKLLSGEYDADDAAGGQVPSSSRAQGTRGYVAPEWA
LSQPVTGKADVYSFGVVLLELLSGQRVSEWLVMEGERTGFQRLVALLKDEMERQDRTSVP
AWLPEFVDARLLGDFSHLQAAAMLDLAVTCVHHDPSRRPSMNTVVQKLIKSQEGVVLSSS
LRHACPAPVRRNSV
Download sequence
Identical sequences I1GX27
XP_014751693.1.954 EG:BRADI1G35310.1 15368.BRADI1G35310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]