SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G36640.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G36640.1
Domain Number 1 Region: 82-277
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.83e-47
Family Eukaryotic type heme oxygenase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G36640.1   Gene: BRADI1G36640   Transcript: BRADI1G36640.1
Sequence length 279
Comment pep:novel chromosome:Brachy1.0:1:32304728:32309174:1 gene:BRADI1G36640 transcript:BRADI1G36640.1
Sequence
MAPAAAASLATPHTLAAPRVSVAVAGRNSGLSVSVGVRQVPGVSAVLSRRRMVATAAATE
MAPAAKGEEGGKAFVEEMRAVAMRLHTKDQAREGEKEPQAPPVAKWEPTIEGYLRFLVDS
KLVFQTLEDIVDRAAVPWYAEFRNTGLERSEQLKKDLEWFRQQGHTIPEPSAPGTTYASY
LEELSEKDPQAFICHFYNVYFAHTAGGRMIGKKVAEKILNKKELEFYKWEGTLSQLLQNV
RNKLNQVALSWSREEKDHCLEETEKSFAYSGDLLRQIFT
Download sequence
Identical sequences I1GXJ3
EG:BRADI1G36640.1 15368.BRADI1G36640.1 XP_003563666.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]