SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G36720.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G36720.1
Domain Number 1 Region: 496-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.59e-74
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 60-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.72e-25
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G36720.1
Domain Number - Region: 345-376
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00184
Family Pan module (APPLE domain) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G36720.1   Gene: BRADI1G36720   Transcript: BRADI1G36720.1
Sequence length 805
Comment pep:novel chromosome:Brachy1.0:1:32394832:32397414:1 gene:BRADI1G36720 transcript:BRADI1G36720.1
Sequence
MDTHSTSLFLLTLIHLLSRISARDFLSAGSSLSVESSSDVLHSPEGTFTCGFNNISENAF
VFSIWFSHTAEKTVIWSANHLHPVYSWGSKVVLDTNGGMVVKDYQGQTVWENNVTSSNAE
RAQLLDTGNLIVKGQGDIILWQSFNSPTDTLLPNQNFTAATKLVSSSRLLVHGQYSFHFD
DQYLLTLFDDEKDISFIYWPNPDQNIWAKERNSFNTTTTGVLDSWGHFSGSDNLTFKAAD
WGLKVMRRITLDSDGNLRLYSLNEQNGGWSVMWAASQGSCFTRGLCGINGICVYTPMPAC
ACAPGYEIIDPSDWRKGCTPKFNLTRHGQKMRFVKLPYTDFPGYDQSKNAPISLDHCKKI
CLNDSNCKGFTYSEQGTGGCYPKSSLFGGVTSLYYSTYLKVPKELEVSNSSIPHSQPSVP
RYVLDCPTTKKYSTPNFLDKPDSSQNGSNYFYLFYGFLSAIFLVEVTLVALGCWFLLIRK
GKQLTGVWPAEVGYEMITNHFRRYTYKELKRATRQFRDQIGRGASGLVYKGVLEDKRVIA
VKRLAGINQGEEEFQHELSVIGRIYHMNLVRVWGFCSDGPHRILVSEYVENGSLDKTLFS
SEGSQILLEWNERFNIALGVAKGLAYLHHECLEWVIHCDLKPENILLDENLEPKITDFGL
AKLLNRGGSNKNVSRICGTRGYIAPEWVSSVPITAKVDVYSFGVVLLELLKGARVSEWAS
NADEEVEMVLRRILRMLAENLKLEGTKQLWISEFIDSRLNSQFDNIQARTMVKLAVSCLE
EDSRKRPTMENALQMLLSVDEAIGI
Download sequence
Identical sequences I1GXK1
XP_010227544.1.954 EG:BRADI1G36720.1 15368.BRADI1G36720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]