SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G36880.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G36880.1
Domain Number 1 Region: 119-213
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1e-30
Family Ribosomal protein L19 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G36880.1   Gene: BRADI1G36880   Transcript: BRADI1G36880.1
Sequence length 217
Comment pep:novel chromosome:Brachy1.0:1:32622968:32625669:-1 gene:BRADI1G36880 transcript:BRADI1G36880.1
Sequence
MQALLRNVCRAGTHGVPKLLDCAAPGVAQLFVKTLRPCSLTRSIGSSVTTPYDSVQTYGF
CMKALLLRGFSTVGTAEVSLEDENSSSPMAEHPPRIKFKRPDKTARHIMNILNKEAVDKV
RTERVIPDIQPGCIVQMRVQVPENKRRESTLKGIVIARRNAGINTTFRLRRLVAGVGVES
VFPLYSPNIKEVKILDRKKVRRAKLYYLRDRMNALKK
Download sequence
Identical sequences I1GXL8
EG:BRADI1G36880.1 EG:BRADI1G36880.3 XP_003563681.1.954 XP_010227552.1.954 15368.BRADI1G36880.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]