SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G36990.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G36990.1
Domain Number - Region: 183-208
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0406
Family CAT-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G36990.1   Gene: BRADI1G36990   Transcript: BRADI1G36990.1
Sequence length 454
Comment pep:novel chromosome:Brachy1.0:1:32823708:32825968:1 gene:BRADI1G36990 transcript:BRADI1G36990.1
Sequence
MGVFAVTKVSEGPVRPSAATPSDTLPLAWVDRYPTHRGLVESVHIYRDAFQPPPAPEAAA
AAAAEEEEDQEKKKNNNNSKKPPAAVVRSALADALVHYYPFAGRIVEDAAKPGRPAVLCC
AEGVYFVEATANCTLADVNFLERPLLLGKEDLVPYPAPELWAVEPHNTLAMIQVTTFTCG
GFVLGLRTNHAVADGTGAAQFLNAVGDLARGLQEPRVKPVWARDRFPDPDIQPGPLPELP
VLALEYIAFDFPVTYIDKIKSEYNACSGGKHCSGFDIVIAKLWQSRTRAIIGIPESSPSA
DVKLCFFASARHVLKIEPGYWGNAIFPVKVTAAAEKVAGSSVVELVSIVREAKKQMAEDC
LSWAEGRTGGRDPFQMSFDYESVYVSDWSKLGFSDVDYGYGTPMTAGPLVNCDLIASVIV
MKAPAPLAGTRLLASCVTKEHAEGFASRMREDIA
Download sequence
Identical sequences I1GXN1
15368.BRADI1G36990.1 XP_003563687.1.954 EG:BRADI1G36990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]