SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G37130.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G37130.1
Domain Number 1 Region: 421-485
Classification Level Classification E-value
Superfamily FF domain 2.22e-16
Family FF domain 0.00066
Further Details:      
 
Domain Number 2 Region: 491-558
Classification Level Classification E-value
Superfamily FF domain 6.28e-16
Family FF domain 0.0013
Further Details:      
 
Domain Number 3 Region: 557-626
Classification Level Classification E-value
Superfamily FF domain 0.0000000000301
Family FF domain 0.0034
Further Details:      
 
Domain Number 4 Region: 188-222
Classification Level Classification E-value
Superfamily WW domain 0.0000000000326
Family WW domain 0.0012
Further Details:      
 
Domain Number 5 Region: 632-707
Classification Level Classification E-value
Superfamily FF domain 0.0000000000327
Family FF domain 0.0033
Further Details:      
 
Domain Number 6 Region: 774-834
Classification Level Classification E-value
Superfamily FF domain 0.00000000068
Family FF domain 0.0057
Further Details:      
 
Domain Number 7 Region: 217-259
Classification Level Classification E-value
Superfamily WW domain 0.00000000129
Family WW domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G37130.1   Gene: BRADI1G37130   Transcript: BRADI1G37130.1
Sequence length 1000
Comment pep:novel chromosome:Brachy1.0:1:32918212:32929609:-1 gene:BRADI1G37130 transcript:BRADI1G37130.1
Sequence
MASNMQASGPPQPPRPPMMGSTAPPQNMGPPIPMQFRPAGPPQQPQFMQPVPQQFRPVGQ
AMPGANMGMPGQMPHFPQPGQHMPHSGHVPPASQAVPMAYQAARPMSSAPMQPQQQAVFP
GGHMPTMGAPMPPPSYTYQPTSVPPVAQSWGTALGQSVPLVPPAVQPGHQSMSASLPSVS
STEPSSSDWQEHTSQDGKKYYYNKRTRQSSWEKPAELMTPLERADASTEWKEFTTAEGRK
YYYNKLTKQSKWSIPDELKIARELAEKASNQQPDRETETTTSGPVGSASVPVEPSLPANQ
SSSVVGIIASTTHDALANLPLPPDAPPGAGLSYNGDIASSHVDTQNGGTSASVVAPVTTS
TGVSSVAIDAGTSRNNYESSSRTITTDTKDGASAEDLEEAKKTMPTAGKINVTPLEEKTS
EEEPPVYANKLEAKNAFKALLESANVESDWSWDQAMRVIINDKRYGALRSHGERKQVYNE
YLNQRKKIEAEERRVKQRKSRDDFLTMLEECKDLTSSTRWSKAITMFEDDERFNAVERPR
EREDLFENYLVELQKKEKAKAAEEHKRHVAEYRAFLESCDFIKASTQWRKVQDRLEDDER
CSRLEKIDRLDVFQEYIRDLEKEEEEQKRIQKEHTRRQERKNRDEFRKMLEEHVADGTLT
AKTHWRDYCAQVKDSRAYLAVASNMSGSMPKELFEDVIEELDKQYQDDKTLIKDELKSGK
IHMTTSWTLEDFQAAVTGDDNCKGISNINIKLIYDDQIERLREKDLKEAKKRQRLGDNFL
DFLYSIKEISATSTWEDSKPLFEDSQECRALDSETYARELFEECVVRLKERLKEKERMRE
EEKVMAKKEKEREEREKKKEKEKERKEKERKEKERDREKEREKEKVKDRSRREEMEIDGA
DMETHGSKDKKREKDKEKKHKRRHHDATDDLSSERDEKDDSKKSRRHSSDRKKSRKHTHA
SDSDSENRHKRHKKDRDSSRRNGAHEELEDGELGEDGEIH
Download sequence
Identical sequences I1GXP6
15368.BRADI1G37130.1 EG:BRADI1G37130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]