SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G37210.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G37210.1
Domain Number 1 Region: 441-739
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-35
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 111-304
Classification Level Classification E-value
Superfamily L domain-like 6.46e-33
Family Polygalacturonase inhibiting protein PGIP 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G37210.1   Gene: BRADI1G37210   Transcript: BRADI1G37210.1
Sequence length 763
Comment pep:novel chromosome:Brachy1.0:1:33020762:33025377:-1 gene:BRADI1G37210 transcript:BRADI1G37210.1
Sequence
MTAPPSSRNPDFAPLLLTLLCCIPAALVTSQPMASTEAKTLSRVSQLLGNPPALAALATA
PDPCALRATPALTVACAGGQVTVLSVLGDRQPDAKWHTALPSSFSADALFTTLTGLPALS
RLSLVALGVWGPLPGAKLLRLQALRALNLSANYLYGAVPDHLSRMYSLQSIVLSRNLLNG
TMPSLSGLAFLEELDVGRNGLDGPFPEVGKAVARLVLADNNFTGKIPAGVSSLGRLQFLD
ASRNQLQGWIPSSIFALPALRRINLAHNELTGQLPARMACAEPLEFVDVSANLLVGARPA
CVRSSNSSGITVLDAGNCFADAKLQRPSTYCNPGALAALLPPPQGNGGDQGGRRKGRGVG
MVFGIVGAIVGGALLIALVMVVVLRRARKQHQHLEVSVLPKSPLVKPVKKAEGGIFQAKV
NHKISPAEKRHASQAARMNTLEVPACHSYTMEELQEVTNNFASSNLIKNSSFVQHYNGQL
QDGSRVLVRCLRLKPKYSPQSLSQYMEIISKFRHRHLVSIIGHCILNDQENPTIASSVYL
ISECVTNGSLRSHLTEWRKREMLKWPQRVSAAIGIARGIQFLHNVTAPDIVQNDLNIENI
LLDKTLTSKISDFSLPMISISKNGKIFSENPFAVHGENDHGSAQIAEQGDKDDTYQFGLI
LLELITGKSTESQTGLDSLKAQLSEALAEDPDMLKDMADPTIRGTFAVDSLSTVTEIALN
CIASDPNYRPSIDDVLWNLQYSMQVQDGWASSESLSLSIKSQA
Download sequence
Identical sequences I1GXQ8
15368.BRADI1G37210.1 EG:BRADI1G37210.1 XP_003560632.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]