SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G37377.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G37377.2
Domain Number 1 Region: 413-685
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-69
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 20-71,110-179
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000136
Family Universal stress protein-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G37377.2   Gene: BRADI1G37377   Transcript: BRADI1G37377.2
Sequence length 737
Comment pep:novel chromosome:Brachy1.0:1:33245611:33250301:1 gene:BRADI1G37377 transcript:BRADI1G37377.2
Sequence
MASSSSSTGGDPQAKPVAVAVAVRGDGRASRRAARWAAANLALVPGRVVLVHVIPPVSFV
PSPCRLAFSSRFPLLLLDFAFRRGVVDVRISGELIFFCVVAMGCSGREGSGGEDGAGGGG
DVETVVLEGDSVSEALARYAAESGVRNLVLGSACLSWFRRILRLQNLPTTVLKATPCSCN
VFIVSRRQLTVKFANLSQTGKSNTYVRIQSISHRAYALIQRNWLQVKHSLHGLPDDETPK
SSGVTSSDLCSQACSSLSTSTNAGRKTPGRAGDKEFDAIGQLKEFPCVSLSSTEGPKPID
DVAKLRKELQNTLMTYGEAHEDVVHAKKKIQVLSNDCSEDLKEVQDALRREELLKQTAAY
EKSKHFRAITDTEMVKEAFTCEAYSKHKTESVANMMSTETGKVVDALLCTGKTCRRYLRH
EIELATDNFSDAKKIGEGGYGIVYRCTLDHTEVAVKVIQQDSSDKIDEFFKEVEILSQLH
HPNLVLLLGFCPEIGCLVYEYMENGSLEDQLINNKGCQPLHWFMRFQIIFEVARGLAFLH
GTKPEPIVHRDLKPGNILLDKNYVSKIGDVGFAKLIADLVPDGFTEYRDTVIAGTLYYMD
PEYQLTGTVRPKSDLFALGIIVLQLLTGKHPHGLILSAEEAIRKDTFSDILDQSQTDWPI
AEAETLAKLGLRCTALKCRDRPNLESEVLPVLEDLLSRVTSSLKSRSPNVVVPSHFVCPI
LQVKFARYSTLSVQLPL
Download sequence
Identical sequences I1GXT4
EG:BRADI1G37377.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]