SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G38170.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G38170.1
Domain Number 1 Region: 207-275
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.4e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G38170.1
Domain Number - Region: 282-332
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.0418
Family Kix domain of CBP (creb binding protein) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G38170.1   Gene: BRADI1G38170   Transcript: BRADI1G38170.1
Sequence length 524
Comment pep:novel chromosome:Brachy1.0:1:34329035:34333975:1 gene:BRADI1G38170 transcript:BRADI1G38170.1
Sequence
MEGADHLYPSIEPYDLEPPQVGIAAAGETRVCDQTVRWDEEPKEGTHLFEQGTKDNPDTN
NVEDCLGGVDIYECNDETITMKEYGEDISPDCTLREQIGIWIPPSVPPMIKHDHEEWQKG
FGSNGGYFPEEEYQWDIDEEIREMTMWDVFAEMAVAGKDKLISIASYDFGRHSMSLISHF
LLQAALEDEARTLAEASAGSEHALLEAEPTKWLPDSAASSCMLCGARFHPIICTRHHCRF
CGGIFCGGCSKGRSLMPPKFGTSDPQRVCDVCGVRLECIQPRLMNKISRACQLPTKDLTD
LSTLRSWINIPWAHTMEYEIYKAANSIHGYCKIGKLNPEKSIPDSILRQAKGLAIITVVK
VGVMITYKIGTGLVIARRADGSWSPPSAISTCGIGYGAQAGGELADFIIVLRNTDAIKTF
SGNAHLSVGAGIGASAAHLGRVAEADFRAGDGGYAACYTYSCSKGAFVGCALNGSLVSTR
NSENARFYGGPIKASEILLGSLAKPPAAATLYKALSILFEKIKI
Download sequence
Identical sequences I1GY35
XP_003563773.1.954 EG:BRADI1G38170.1 15368.BRADI1G38170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]