SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G41907.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G41907.2
Domain Number 1 Region: 1144-1341,1411-1454
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.41e-39
Family Pyruvate phosphate dikinase, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G41907.2   Gene: BRADI1G41907   Transcript: BRADI1G41907.2
Sequence length 1455
Comment pep:novel chromosome:Brachy1.0:1:38621582:38634352:1 gene:BRADI1G41907 transcript:BRADI1G41907.2
Sequence
MGGFSAAERCAVGIHASLSSPAARPRALKQTAPVRRASHRASTTLAVSGRRLLVPRAVAT
PTDRASPDIVGTFNLDSNSELQVTLNPAPQGAVAEINLKATNTRGSLILHWGALCPDKRE
WLLPSRRPDGTTVYKNQALRTPFIQSGDNSMLSIEIDDPAIQAIEFLVFDEAQNKWFKNN
GQNFLIQLQTSHNQGQYASGASASAATVPEDLVQVQSYLRWERNGKQSYTPEQEKLEYEA
ARAELIEELNRGVPLEKLRARLTKSPNANESDAPASQTTVAKVPEELVQVQAYIRWEKAG
KPNYSPEKQLVEFEEARKELQAELDKGASIDQLRKKILKGNLEKKVSKQLENKKYFSVER
IQRRNKDIMQLLNKHKPVITEEQVKAAPKQPTVLDLFTKSLQEEDGFDVLSRKLFKFGDK
EILAIAANSLGKTKVHLATNHVEPLILHWALAKNGGEWEAPPSSIVPSGSTVLDKACETS
FSKSELHGLQYQVVEIELDDRRYNGMPFVLRCGETWIKHNESDFYLDFNTKVTKKAKDTG
DAGKGTAKVLLERIADLEEDAQRSFMHRFNIAADLVDQARDAGLLGIVGLFVWIRFMSTR
QLIWNKNYNVKPREISKAQDRFTDDLENMYRSYPQYREILRMILSAVGRGGEGDVGQRIR
DEILVIQRKNDCAGGMMEEWHQKLHNNTSPDDVVICQAIIDYIKSDFDISVYWDTLNKNG
ITKERLLSYDRAIRSEPKFRSDQKESLLSDLGNYMRSLKAVHSGADLESAIASCMGYKSE
GEGFMVGVQINPVKGLSSRFPELLQFVLDHVEDKSAEPLLEGLLEARVELRPLLIDSSER
LKDLIFLDIALDSTFRTAVERSYEELNNAAPEKIMYFIGLVLENLALSTDDNEDIIYCLK
GWNQALEMAKQKDDQWALYAKAFLDRTRLALASKGEQYYNMMQPSAEYLGSLLNIDEWAV
NIFTEEIIRAGSAATLSALLNRFDPVLRNVAHLGSWQVISPVEVTGYIVVVDELLSVQNK
SYDKPTILVAKSVKGEEELPDGVIGVITPDMPDVLSHVSVRARNCKVLFATCFDPNILSE
LQGHEGKVLSFKTTSADITYREIAESELLQSSSPNAQAGEAVPSLSLVKKKFLGKYAISA
EEFSEEMVGAKSRNIAYLKGKVPSWVGVPTSVAIPFGTFEKVLSDIMNKEVAQNIQLLKA
RLVQDELSVLREMRKTVLDLTAPAEFVKNLKDKMVASGMPWPGDESEQRWEQAWMAIKKV
WASKWNERAYFSTRKVKLDHDYLSMAVLVQEIVKADYAFVIHTTNPSSGDSSEIYAEVVK
GLGETLVGAYPGRAMSFVCKKDDLNSPKVLGYPSKPIGLFIKRSSIIFRSDSNGEDLEGY
AGAGLYDSVPMDEEDEVVLDYTTDPLITDPGFRNSILSSIARAGHAIEELYGSPQDVEGA
VKDGKIYVVQTRPQM
Download sequence
Identical sequences I1GYJ5
EG:BRADI1G41907.2 XP_010227681.1.954 XP_010227682.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]