SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G42257.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G42257.2
Domain Number 1 Region: 15-279
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-80
Family Protein kinases, catalytic subunit 0.00000789
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G42257.2
Domain Number - Region: 658-687
Classification Level Classification E-value
Superfamily BLRF2-like 0.0314
Family BLRF2-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G42257.2   Gene: BRADI1G42257   Transcript: BRADI1G42257.2
Sequence length 698
Comment pep:novel chromosome:Brachy1.0:1:39248064:39257792:-1 gene:BRADI1G42257 transcript:BRADI1G42257.2
Sequence
MEHAPRSRGYPTDPKEYKLYEEVGEGVSATVYRALCVPLNVLVAIKVLDLEKCSNDLDGI
RREVQTMSLINHPNLLRACCSFANGHQLWVVMPFMAAGSALHIIKTNFPDGFEESVIATL
LWEVLKALVYLHSQGHIHRDVKAGNILIDTNGAVKLGDFGVSACMFDTGNRQRARNTFVG
TPCWMAPEVMQQLHGYDYKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLD
YERDKRFSKSFRDLVAACLVKDPQKRPSSEKLLKHSFFKQARSAEFLARSILEGLPPLGD
RFRALKAKEADLLLNNKLGPESKEQLSQKEYIRGISGWNFNLEDLKTAAALLDSSNGTYS
FNGTNKRDVNGLREAYNEAENVYQERVNHGASARHVEDEIQEVEDLNGELASSFPTRPLE
ALKSCFDVCGDGILDPTATNLRVQPSAEPISPVQQSSQIEHDRSSNCNGESLERSVSVPS
NLGNSVYQKFSSGSLIPEHVLSPYRNVGSDSQRSEFHQRSQSTRNRSGPLLFRQMKDSRP
HPSVAPDEPSEGNVVHRRGRFQVTSDNPAQKVAPLASSSRVNLASGVTRPISNSSTVLPT
LQFLMQQNTMQKEILSRLISSIEETSDASDASIVGPSQSSGTHSKEKELESYVVNLQRSV
TELAEEVQRLKLRNNQLEKQINALSKEDERLRREDTKQ
Download sequence
Identical sequences I1GYL3
EG:BRADI1G42257.2 XP_010227694.1.954 XP_014752992.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]