SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G42377.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G42377.1
Domain Number 1 Region: 494-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-81
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 104-227
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-20
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G42377.1
Domain Number - Region: 374-409
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0231
Family Pan module (APPLE domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G42377.1   Gene: BRADI1G42377   Transcript: BRADI1G42377.1
Sequence length 838
Comment pep:novel chromosome:Brachy1.0:1:39423028:39425887:-1 gene:BRADI1G42377 transcript:BRADI1G42377.1
Sequence
MVSEDCQLWGISFIHMKGSSKGHWSSICFIMLWMLVLANLWIICSGSTQRQVLLPGFIGS
EMDYIDNNGIFLLSNASLFGFGFVTSSTSESTSYLLAVIHLASTSVVWTANANSPVSHSD
SFVFDKDGNAYLQSVGSAVWTANISGKGASMQLLDSGNLVVLGKDSSSPLWQSFSYPTNT
LLSGQSFIDGMTLVSQSNTQNMTYTLQIKSGDMMLYAGFKKPQPYWSVLQDNKLIVNKNG
AIYSANLSSTSWYFYDQTGSLLSQLVISQQGDANTTFAAVLGNDGSITFSMLQSGNGKTT
LPTTIPQDSCDTPAHCKPYSICNSGTGCQCPSALSSFSNCNPGLVSPCNSKEVFQLAQLD
TGVGYIGTSFTSPMANTNITGCKNACMGNCSCVAMFFDQTSGNCFLFNEIGSLQQKGGSK
ANYASFIKVSSSNHGSGQGGDGSGQHTIIIVVILVGTLAVIGVLVYVGFFIYRRKRYPPH
SQDEAGSSEDDGYLQTISGAPMRFTYSQLEDATNNFSNKLGQGGFGSVYLGTLPDGSRIA
VKKLESIGQGKKEFRSEVTIIGSIHHIHLVKLRGFCAEGSHRLLAYEYMAKGSLERWIFR
AKEDDPLLDWDTRFNIALGTAKGLAYLHQDCESKIIHCDIKPENVLLDENFLVKVSDFGL
AKLMSREQSHVFTTLRGTRGYLAPEWITNYAISEKSDVYSYGMVLLEIISGRKNFDPVEG
SEKAHFPSFAFKKLEEGDLREIFDAKLKYNDKDERLEIAIKVALWCIQEDFYQRPSMSKV
VQMLECVCDVPQPPTSSQIGYRLYANAFKSSSEEGTSSGMSDYNSEALLSAVRLSGPR
Download sequence
Identical sequences I1GYM6
XP_010227705.1.954 XP_010227706.1.954 EG:BRADI1G42377.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]