SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G43210.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G43210.1
Domain Number 1 Region: 827-861
Classification Level Classification E-value
Superfamily WW domain 0.000000049
Family WW domain 0.0027
Further Details:      
 
Domain Number 2 Region: 166-205
Classification Level Classification E-value
Superfamily WW domain 0.000000209
Family WW domain 0.0034
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G43210.1
Domain Number - Region: 495-510
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00112
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G43210.1   Gene: BRADI1G43210   Transcript: BRADI1G43210.1
Sequence length 862
Comment pep:novel chromosome:Brachy1.0:1:40808736:40815636:-1 gene:BRADI1G43210 transcript:BRADI1G43210.1
Sequence
MGRRKERRLAAKAASGRRVKLDLFLDASPGDASSKEGVGGENREQQSGVPTSPSSSDKKE
NPLALLGQYSDDEEEDDGAGAQPNGEANGSPTNASVEVTHERDNTAGDNDVVHSEPPASD
SGQQVAPQADGVNNFTENVAEQITAAPEPTPENGCVTETEAIPDSSGMQIVGDIGGNWKT
VMHEQSNQCYYWNTVTGETSWEIPNGLAPGVVADGVTSASIPTHVEYSIEAQAHVPHSNV
EAYPSDVSIGNGTSAYTAMGMVCARGQLTQNAYAYTGAVASHESMDIDPLRLAKYGEDLL
QRLKLLERPHGAIDSLELIKREIEIRVSDCNVLSSYGSSLLPLWLHAEVHLKQLEFSVSK
FEASYTAYTHPETEHAEYKAPNEAEILAPSDAEGLKFEVITVVPMDENLKVEEPCSTASV
QNSEEKDAAAVTSRVEPDCDEDMDVEMEVDEENVEDQGCSSSMPNEEHHSSEQVRSPTLP
SLEKSAPPPEDNDIPPPPPPEEEWIPPPPPENEPAPPPPPEPEETTVVSYVHTDTLTQSY
VDQANFGYALPGMEYYPAAGTDGTNANYYMQASDSHILQSQQHSYYAPVSAGGISIPVDA
ASIPPVPGSYYSYPSVTMDASGVAAESSGYYASSTSTISSSALDNKTTSAPIDATNSDVN
PIESDKVISKEAKIASLSQAVGATSASGTVRGSSTQASTSTTNQTKVHRTKKRPVAVASS
LRSNKKVSSLVDKWKAAKEELRDEEEEEPEDALEALEKKRRKEIDGWRKQQIASGEAKEN
ANFVPLGGDWRDRVKRRRAEAKKESKSEFIQAVPEQHKGQPDLVELSKGLPSGWQAYIDE
STKQVYYGNNLTSETTWDRPTK
Download sequence
Identical sequences I1GYX6
15368.BRADI1G43210.1 EG:BRADI1G43210.1 XP_003563936.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]