SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G43490.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G43490.1
Domain Number - Region: 45-83
Classification Level Classification E-value
Superfamily Histone-fold 0.0356
Family TBP-associated factors, TAFs 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G43490.1   Gene: BRADI1G43490   Transcript: BRADI1G43490.1
Sequence length 138
Comment pep:novel chromosome:Brachy1.0:1:41291692:41292793:1 gene:BRADI1G43490 transcript:BRADI1G43490.1
Sequence
MEGRNQANDHGNNAREGNSTRTTFPTSNLKDAVEQSVELSPPAEPKKMTLEGDSVLDDME
ELSFDDYVQPLSDYLRLYYELHDLVRRDDRQPAPPPPAAAVTTVEMPPPPPPQPSGAAAA
STSRMPPASAAAPARDDE
Download sequence
Identical sequences I1GZ07
15368.BRADI1G43490.1 EG:BRADI1G43490.1 XP_010229874.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]