SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G44440.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G44440.1
Domain Number 1 Region: 37-316
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.17e-31
Family G proteins 0.00066
Further Details:      
 
Domain Number 2 Region: 580-700
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-19
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G44440.1   Gene: BRADI1G44440   Transcript: BRADI1G44440.1
Sequence length 911
Comment pep:novel chromosome:Brachy1.0:1:42620688:42629717:-1 gene:BRADI1G44440 transcript:BRADI1G44440.1
Sequence
MEAMEELSQLSESIRQAASLLADDDPSDDAAPRRPSTFLNAVVLGNVGAGKSAVLNSLIG
HAVLPTGENGATRAPIVVELQREPGLSSKSIVLQIDNKSQPVSSSALRHSLQDRLSKAAS
SGSGRGRMEEIPLKLRTSTAPPLKLIDLPGLDQRVVDDSMINDYAGHNDAILLVVIPAVQ
AAEVASSRALRLAKDIDSDGTRTIGVLSKIDQATGDAKTIACVQALLSNKGPKNLPDIEW
VALIGQSVAIASAGSVGSENSLETAWQAEAETLKSILTGAPSSKLGRVSLVATIAKQIRK
RMKVRLPNLLTGLQGKSQIVQDELARLGESMVQSAEGTRAVALELCREFEDKFLAHITSG
EGSGWKIVASFEGKFPDRIKQLPLDRHFDLSNVKRIVLEADGYQPYLISPEKGLRSLIKI
VLEMAKESSRLCVEEVHRVLLDIVNASANATPGLGRFPPFKREVIAIASSALDSFKNDAK
KMVVALVDMERVYVPPQHFIRLLQRRMERQRREDEMKNRPPKKGQEAEQSVTNRASSPQT
KSEQAGGSGSLKSTKEKPSQQDKDTKEGPNLQVAGPTGEITAGYLLKKSAKTNGWSRRWF
VLNEKSGKLGYTKKQEERHFRGVITLEECNLEEVEDEEPSKSLKDSKKSNGPEKGPSLVF
KITNRVAYKTVLKAHSAVVLKAESIADKVEWVNKIKAVIQSKGGSFKGPNTEGVSMKQSH
SDGSLDAMVRRPADPDEELRWMSQEVRGYVEAVLNSLAANVPKAIVLCQVEKAKEDMLNQ
LYSSISGQSNAKIEELIQEDHNAKRRREKYQKQSSLLSKLTRQLSIHDNRAAASSYSNDS
PEAESPRTPGRPGEDWRSAFDSAANGPTAASSSSERSRSADGRNRRSENGDVSNSGSRRT
PNRLPPAPPRY
Download sequence
Identical sequences I1GZB5
EG:BRADI1G44440.1 15368.BRADI1G44440.1 XP_003564004.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]