SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G45150.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G45150.1
Domain Number 1 Region: 164-245,299-364
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.44e-20
Family Galectin (animal S-lectin) 0.0072
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G45150.1
Domain Number - Region: 57-125
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.0186
Family Substrate-binding domain of HMG-CoA reductase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G45150.1   Gene: BRADI1G45150   Transcript: BRADI1G45150.1
Sequence length 637
Comment pep:novel chromosome:Brachy1.0:1:43340084:43344221:-1 gene:BRADI1G45150 transcript:BRADI1G45150.1
Sequence
MKKWHGGSVIVSLFVILLLRYVILDSPLAERSLQNVFQQNSTTQLHWLEVPNPPALQNPE
NFSQVISTELLASNLSITRNLSDREIQSLHSWNHLRDLVSNAHILPDGLDAIKEAGIAWS
KLNAALEQDESIVSVNGSTQHKDKEKQCPYSIRRMNATRLGDRYVLKIPCGLIQGSSITI
IGTPGGLLGDFKIDLTGAAVPGEPDPPIVLHYNVRLLGDKLTEDPVIVQNTWTIADDWGS
EHRCPSPDSDAKDSAKVDDLEKCSSMVGNDQKQFLASKLHSNASSMQPTRKMTAERKKYY
PFRQGYLAIAILRVGAEGIHMTVDGKHVTSFALREDLEPGFVGEVRIAGDIKLLSVIASG
LPTTEDFEHVTDLEILKAPPVPMDKLVDLFIGIFSTANNFKRRMAVRRTWMQYDAVRSGK
VAVRFFVGLHKNEVVNEELWNEARTYGDIQLMPFVDYYSLILWKTIAICIYGTNVLSAKY
VMKTDDDAFVRVDEILSSLHQANISHGLLYGRVNSNSQPHRDPYSKWYITPEEWPEESYP
PWAHGPGYIVSQDIAKEVYRKHKRGELKMFKLEDVAMGIWINEMKKEGLDVKYQNDGRIL
VEGCEDGYVVAHYQEPRQMMCLWDKFQKTKRGSCCKE
Download sequence
Identical sequences I1GZJ3
EG:BRADI1G45150.1 15368.BRADI1G45150.1 XP_003564048.1.954 XP_010227827.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]