SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G45250.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G45250.1
Domain Number 1 Region: 260-648
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.03e-89
Family Regulator of chromosome condensation RCC1 0.00072
Further Details:      
 
Domain Number 2 Region: 22-130
Classification Level Classification E-value
Superfamily PH domain-like 5.99e-27
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G45250.1   Gene: BRADI1G45250   Transcript: BRADI1G45250.1
Sequence length 674
Comment pep:novel chromosome:Brachy1.0:1:43464864:43471399:1 gene:BRADI1G45250 transcript:BRADI1G45250.1
Sequence
MAATFYDHIDADYSKNNPFERDVEQAIAALKKGTHLLKYGRRGKPKFCLFRLSNDETMLI
WYSGRMEKQLNLIQVSKIIPGQRTAIFLRYPRPDKEYQSFSLIYGQRSLDLICKDKDEAE
AWFVGLKALISGRSCKWPRETKNDKASYRPINHSRGDSPFASRVIILMLKASESIQRFGT
NQDARAFANFGNIFSDVILYSGQESSRVSSTGSVSTSNSILSGSADTSNGGLPGVANNVT
VSHSSAVSSCSYGSSDDFDSLGDVLIWGKGVGDGTLAHSSDLSGKSYSCSIDASIPKALE
STILLDIHGIACGSKHSVLVTKQGEMYSWGEESGGRLGHGVDTDVIHPKVISTLSAISIE
SVACGEFHTCAVSFCGDLYTWGDGMHNFGLLGHGNDTAHWIPKKVCGLLEGLHISSVSCG
PWHTAVVSSAGQLFTFGDGVFGALGHGDRRSTTVAREVDSLRGMHTIRAACGAWHTVAIV
EVVDSPSFGTSSKLFTWGDGNKGQLGHADRETRLIPTNVGSLSNPRFCQVACGYDITVAL
STSGEVYTMGSNAFGQLGNPITNGKLHTLVEGSISSSSVEEIACGSHHVAVLTSKAEVYT
WGKGANGRLGHGNNFDRNTPTLVEALKDKQVKSVVCGIDFTVVVCLHKCTSGLDQSICSG
CHLQFGFRRMRHKI
Download sequence
Identical sequences I1GZK4
EG:BRADI1G45250.1 15368.BRADI1G45250.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]