SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G47520.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G47520.1
Domain Number - Region: 100-130
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.0277
Family N-acetyl-l-glutamate kinase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G47520.1   Gene: BRADI1G47520   Transcript: BRADI1G47520.1
Sequence length 193
Comment pep:novel chromosome:Brachy1.0:1:46104269:46107514:1 gene:BRADI1G47520 transcript:BRADI1G47520.1
Sequence
MASLDVRIKLSPPNNCGINETSHLTKEMLPEVIGVGLLVLFGRAINHRSFVSLVRFISHL
VMAYVFTFWTCYVLMKEYENVTTMRLCFLVSEKLQPDQLPDSSGRDGMQTKVASAVTAAS
KGVPAVIVRSSYDSIRPYKVDKAPRISNEKNIVKAELVFHRGIAIFSPPPCLSSSSASGQ
CCSSLLPNLDAFQ
Download sequence
Identical sequences I1H0E9
EG:BRADI1G47520.1 15368.BRADI1G47520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]