SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G48380.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G48380.1
Domain Number 1 Region: 524-823
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-71
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 72-216
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-28
Family alpha-D-mannose-specific plant lectins 0.0015
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G48380.1
Domain Number - Region: 374-421
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00824
Family Hairpin loop containing domain 0.059
Further Details:      
 
Domain Number - Region: 257-335
Classification Level Classification E-value
Superfamily Tetraspanin 0.0942
Family Tetraspanin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G48380.1   Gene: BRADI1G48380   Transcript: BRADI1G48380.1
Sequence length 828
Comment pep:novel chromosome:Brachy1.0:1:47017263:47019950:1 gene:BRADI1G48380 transcript:BRADI1G48380.1
Sequence
MAAMRGACIFTTSIFFLSMLISVNALAKDHGSSYLARGSTVDTWDGETTAILVSPNGAFA
CGFYRVATNALTFSVWFHASSRRKTVVWTANRDEPVNGRGSSLAFRKDGGLALLDYNGTA
VWSTNTTATSASHAKLLDNGNLVVMDPGGRSLWGSFDSPTDTLLPSQPMTRNTKLVSASA
RGLLYSGLYTLYFDSDNQLKLIYNGPEISSIYWPNPFNKPWVNKRSTYNSSRYGILEETG
RFVASDKFEFEASDLGDKVMRRLTLDYDGNLRLYSLNPTSGNWSVSWMAFHRVCDIHGVC
GKNSMCKYIPKLQCSCLKGFEVIDASNWSEGCRRKANITASWDKHRRDNANITASWDKHR
RANANSTTTQDFSFRKLAETDFYGYDLAYDEWIPFSKCRNMCLGYVDCQAFGYRKGEGKC
FPKVYLFNGKNFPDPPNDIYLKVPKGLLPSPELASTIAYECKVHEKEANVSLQMLKGGTS
KFKFGYFLSSALTLLFIEVTLIIAGCCVVYKSERRVEIADEGYMIISNQFRIFSYRELQK
ATRCFQEELGSGGSGAVYKGVLDDERKVAVKKLNDVIQGEQEFRSELSVIGRIYHMNLVR
IWGFCAEKTHRLLVSEFIENGSLDRALFDYQSLFPVLQWSQRYKIAVGVAKGLAYLHTEC
LEWIVHCDVKPENILLDEDFEPKIADFGLVKLLTRGSNTEMLSRVCGTRGYIAPEWALNL
PITGKVDVYSYGVVLLELVKGVRVSRWLVEGEEGVEMAVRCSTQILKEKLAGEDQSWLLE
FVDYRLDGEFNHSEAILMLKIAVSCVEEERSRRPSMGHVVETLLSLVE
Download sequence
Identical sequences I1H0Q3
EG:BRADI1G48380.1 15368.BRADI1G48380.1 XP_003564268.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]