SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G48510.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G48510.1
Domain Number 1 Region: 420-700
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-71
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 151-262
Classification Level Classification E-value
Superfamily TPR-like 1.44e-37
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 3 Region: 10-138
Classification Level Classification E-value
Superfamily TPR-like 2.39e-28
Family Tetratricopeptide repeat (TPR) 0.00021
Further Details:      
 
Domain Number 4 Region: 729-799
Classification Level Classification E-value
Superfamily RING/U-box 7.77e-26
Family U-box 0.002
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G48510.1
Domain Number - Region: 247-448
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0112
Family ABC transporter ATPase domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G48510.1   Gene: BRADI1G48510   Transcript: BRADI1G48510.1
Sequence length 805
Comment pep:novel chromosome:Brachy1.0:1:47104810:47109304:1 gene:BRADI1G48510 transcript:BRADI1G48510.1
Sequence
MEAGDERAAEAQREKEAGNAAYHKLFLETAVLHYTRGADLDPRDISFLTNRAAAYLLMSK
YKECVRDCDEAVEKGRELRADNRLVARALSRKASALLKLAGCAGDYAPAIRALQQSLAEH
YSEETRAKLREAETARKEVEEQERLDQEASDYHREKGNEFFKQKKYQEAASHYTEAIKMN
PNDPRVFSNRAQCHIYLGNLPEGLEDAENCIEVDPTFLKGYVRKANVQFLMDNYESALAT
YVEGLKYDPNNIDVIDGLRRCAACIKSSNGGHVEPVDLKEILGDFRSDDDLRSKLQRNME
EAAVFKKEASDERLRRIESERMARTSEDLYLNQVQQRKETEEYLSKVQEELQQLKVRQDE
FIDELQKANEHNEDLQHQLSELSESRERYDQLLSEHDHLLHERNHAVREVDELRQRRGQI
LSVLLTAMHCEFSSSELERATENFNSSLKIGEGGFGCVYRGVLRNMAVAIKVLRPDGLQG
RSQFEQEVAILSRVRHPNLVTLLGACSESSTLVYEFLPNGSLEDFLVCAEKRQTLTWQIR
IQIIAEICSALIFLHENKPHPVVHGDLKPANILLDVNLVSKLSDFGISRLLIQSSSDNTT
LYRTMHPVGTPMYMDPEFLATGEMTPRSDVYSFGIVVLRLLTGRPPVGIKKIVEDAMEEG
DLNTIIDTSAGEWPDVHVQQLAYLALRCTELSRKCRPDLSGDLWRAVEAMRDATTLCSPS
SSRSVLDENRTPSYFICPISQDVMNDPHVAADGFTYEGDCIRSWLSTGRETSPMTNLPLQ
HDELIPNLALRSAIQEWLQLQNTAL
Download sequence
Identical sequences I1H0S0
XP_003564276.1.954 15368.BRADI1G48510.1 EG:BRADI1G48510.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]