SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G49060.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G49060.1
Domain Number - Region: 257-375
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000571
Family NRPS condensation domain (amide synthase) 0.014
Further Details:      
 
Domain Number - Region: 68-196
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000956
Family CAT-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G49060.1   Gene: BRADI1G49060   Transcript: BRADI1G49060.1
Sequence length 473
Comment pep:novel chromosome:Brachy1.0:1:47809650:47811463:1 gene:BRADI1G49060 transcript:BRADI1G49060.1
Sequence
MDPPPPPQLRVLDTVQLFAPPPHPRGESELSPSPLAPLSGLDADPNVLGVTFRSVRFFPP
HPVSLDPLDTLQRAFAAALALFPQLAGSLRVLDRAAAVVVFSGSNAVPLVLAASDGLSVA
EAVDADAPDSPLLDLLAPADVDAGVAGPALALQATRFACGGVALGMRVAHALCDGAGATR
FLAAAARFARGEPVAPPVWARRELLGPRDPPRVVAPSFDTVLAPDYDAVGPYGGHGHEQQ
KLLKVCFHVSDVRVETLRARLSAEAAGVRLTTFEVLAAFIWRARVKANGTSPEETVKMVY
SMNISKLLDPPLPEGYWGNVCVPVYVSLTSGDLLGRSLAETATLVRKSKREVDDEYVRSY
VDFLELRRREGVTATAGRGGVSAFTDWRRLGHGEVDFGWGGPDAVLPLSWRILGSEEPCF
LVPYGISDERRRRGFKVFVAVRETAVACFREEMEEILLLQQEERGNYSTAGKL
Download sequence
Identical sequences I1H0Y3
15368.BRADI1G49060.1 EG:BRADI1G49060.1 XP_003561089.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]